KEGG   Brucella abortus 2308: BAB2_1150
Entry
BAB2_1150         CDS       T00304                                 

Name
(GenBank) TonB-dependent receptor protein:Pollen allergen Poa pIX/Phl pVI, C-terminal
  KO
K16087  hemoglobin/transferrin/lactoferrin receptor protein
Organism
bmf  Brucella abortus 2308
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmf02000]
    BAB2_1150
Transporters [BR:bmf02000]
 Other transporters
  Pores ion channels [TC:1]
   BAB2_1150
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-ProteinID: CAJ13316
UniProt: Q2YJB2
Position
II:complement(1141920..1143905)
AA seq 661 aa
MKFTRTLVLVSTSLLATVATSQAQEVKRDTKKQGEVVLKPITIISHGKDNIEATGGTVLT
YKDIEKLQPANVSELFSRQSSIAVSGGGGPSKRIHVLGMEQSNLAVSVDGVPQTATSWHH
TGSNVIDPAFLKRVEVEAGAAAADSGFGAAAGAIRYETVNALDLLEPGKTFGARIIGSYG
TNGRGFSGSTAAYGLKDGFDWLLMLHGTSGHNYKNGDGTEILGTEPAARNILGKAGYEFD
GNRIDIGYERSRDKADRLIKMNMGLPGDTEYPLEVARDSVNIKYTRTDATDMWDPEVQFY
YNRNDYWRNDYQNRTNGNMILKEDLYGGKLQNTFTIDYGKITAGIDFGKHDYNTDNYGHN
DRRYRKFNTQQVGAFTQGRFEFDNGFSLSTGARYDYSRFADWNDEVFSDSGASVNGTLSY
KFNEHIEVFAGASRTWLGYVLGDYGYVHARNNAFYTDPTFSPGRARNYKAGVNFGGADWS
AGITLFDTRIAGLPNYDSQKLGNDPEEYRSRGFTLNARYIWNYTTIGATFTKAKVTAGDD
PVLPNSGSFMPIGDMATLFIDQEIPDYNMKVGATLAWAGRISDEAATAANFYDQPAYTVV
NAYAEWNPPAVKNMTLRVGVENLFNENYYERTSFAPSQNRGGIDAVWAPGRTFTFQTAFK
F
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaagttcacgagaacgctggtgctcgtcagcacatctctgcttgccaccgtcgccaca
tcgcaggctcaggaagtaaagcgtgatacgaaaaagcagggtgaagttgtccttaaaccc
attacgatcataagccacggcaaggacaatatcgaagcgaccggcggcactgtccttact
tataaagatattgaaaagctgcaacctgccaacgtttccgagttgttttcgcgccagtcc
tccatcgctgtttccggcggtggcggcccgtcgaagcgtattcacgttcttggcatggag
caatccaatctggcggtcagtgtggatggcgtgccgcaaacggcgacaagctggcaccat
acgggttccaacgtaatcgatcctgcgtttctcaagcgcgtggaagtggaggccggagcg
gccgccgcagattccggctttggcgcggccgctggtgcgatccgctacgagaccgttaat
gcgctcgatctgctggagccgggcaaaaccttcggtgcgcgcatcataggttcctacggt
acaaatggcaggggtttttccggcagtaccgccgcctatggcctcaaggatggcttcgac
tggctgctgatgctgcatggcacgtcgggccacaattataaaaacggcgatggaaccgaa
atactcggcaccgagcctgccgcgcgcaatattctgggcaaggccggttatgaattcgac
ggcaaccgcatcgatattggctatgaacgcagccgcgacaaggccgaccgtcttatcaag
atgaatatggggctgcccggcgacaccgaatatccgcttgaggttgcgcgtgattccgtg
aacataaaatatacccgtaccgatgctacggacatgtgggatccggaggtgcagttctat
tacaatcgcaacgattattggcgcaacgattatcagaacaggacaaacggcaacatgatc
ctcaaggaggatctgtatggcggcaagttgcagaatactttcacgatcgactacggcaag
attaccgccggtatcgattttggcaagcacgactacaatacggacaattacggtcataat
gaccgccgctaccgcaagttcaacacccagcaggtcggtgcattcacgcaaggccggttt
gaattcgataacggcttcagcctttcgacaggtgcccgctatgactatagccggtttgcg
gactggaacgatgaggtgttttcagatagcggcgccagcgtgaacggcacgctatcatac
aagttcaacgagcatatcgaggtttttgccggtgcttcacggacctggcttggctacgtc
ctcggtgattacggctatgtccacgcccgcaataatgctttctataccgacccgaccttc
agccccggaagggcgcgcaattataaagcgggtgtgaatttcggcggtgcagactggagt
gccggcattacgcttttcgacacgcgcatcgccggtctgccgaattatgacagccagaag
cttggcaacgatccggaagaatatcgttcgcgaggctttaccctcaatgcgcgctatatc
tggaactacacgaccattggcgcaacctttaccaaggccaaggttacggcgggcgacgac
ccagtcttgccgaacagcggcagcttcatgccgatcggtgatatggcgacgcttttcatc
gaccaggaaatccccgactacaatatgaaagtgggtgctacgctggcctgggcgggtaga
atttcagacgaggctgctactgctgccaacttctacgatcagcctgcctatacggttgtc
aacgcctatgcggaatggaatccgccagcggttaagaatatgacgttgcgcgtgggtgtc
gagaacctgttcaacgaaaactattacgagagaaccagcttcgcgccgagtcagaaccgt
ggtggcatcgatgcggtttgggcgccgggccggaccttcactttccagacggccttcaag
ttctga

DBGET integrated database retrieval system