KEGG   Brucella melitensis M5-90: BM590_A1765Help
Entry
BM590_A1765       CDS       T01849                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmg  Brucella melitensis M5-90
Pathway
bmg00071  Fatty acid degradation
bmg00072  Synthesis and degradation of ketone bodies
bmg00280  Valine, leucine and isoleucine degradation
bmg00310  Lysine degradation
bmg00362  Benzoate degradation
bmg00380  Tryptophan metabolism
bmg00620  Pyruvate metabolism
bmg00630  Glyoxylate and dicarboxylate metabolism
bmg00640  Propanoate metabolism
bmg00650  Butanoate metabolism
bmg00900  Terpenoid backbone biosynthesis
bmg01100  Metabolic pathways
bmg01110  Biosynthesis of secondary metabolites
bmg01120  Microbial metabolism in diverse environments
bmg01130  Biosynthesis of antibiotics
bmg01200  Carbon metabolism
bmg01212  Fatty acid metabolism
bmg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BM590_A1765
   00630 Glyoxylate and dicarboxylate metabolism
    BM590_A1765
   00640 Propanoate metabolism
    BM590_A1765
   00650 Butanoate metabolism
    BM590_A1765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BM590_A1765
   00072 Synthesis and degradation of ketone bodies
    BM590_A1765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BM590_A1765
   00310 Lysine degradation
    BM590_A1765
   00380 Tryptophan metabolism
    BM590_A1765
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BM590_A1765
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BM590_A1765
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BM590_A1765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmg04147]
    BM590_A1765
Enzymes [BR:bmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BM590_A1765
Exosome [BR:bmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM590_A1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADZ87709
Position
I:complement(1721368..1722852)
Genome map
AA seq 494 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCISAAAWAWPFVSSGIDPVLERHLKPTANFGRVPEEGCFFP
AKVNAERKHAGESVLFRLRPMACDCGQIPDVVRTNTENPAISDSSLIRSRVVPYINRALP
PHPSLGKASARIET
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggttgcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcaaattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaagggggatgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgatccccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgctatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atctcggcggcggcatgggcgtggccctttgtgtcgagcgggattgatccggttttagaa
cgtcatctgaaaccaaccgccaatttcgggcgtgtgccggaagaggggtgtttttttccg
gcaaaagttaacgcagaacggaaacatgcaggggaaagcgtgctgtttcggctccgccct
atggcgtgtgactgcggccagataccagatgttgtgagaacaaatacagaaaatccagcc
atcagcgattcgtcgctgattcgttccagagtcgttccatatattaaccgggcgcttccg
cctcatccctctcttgggaaggcatctgcccgcattgaaacttaa

DBGET integrated database retrieval system