KEGG   Brucella melitensis M5-90: BM590_A1912Help
Entry
BM590_A1912       CDS       T01849                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmg  Brucella melitensis M5-90
Pathway
bmg00020  Citrate cycle (TCA cycle)
bmg00640  Propanoate metabolism
bmg00660  C5-Branched dibasic acid metabolism
bmg01100  Metabolic pathways
bmg01110  Biosynthesis of secondary metabolites
bmg01120  Microbial metabolism in diverse environments
bmg01130  Biosynthesis of antibiotics
bmg01200  Carbon metabolism
Module
bmg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BM590_A1912
   00640 Propanoate metabolism
    BM590_A1912
   00660 C5-Branched dibasic acid metabolism
    BM590_A1912
Enzymes [BR:bmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BM590_A1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADZ87856
Position
I:complement(1878072..1879268)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTLPGPLYVVKSQIHAGGRGKGKFK
ELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYL
SILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLE
GGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFRHPDIV
ELRDLTEEDPKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVEGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaagcgcctgcttcacacctacggcgcgccgatcgcc
aatggtgtggctgtctattccgtcgaacaggcggaagaatgggcaaagacgcttcccgga
ccgctttatgtcgtcaagagccagatccatgctggcggacgcggcaagggcaagttcaag
gaactgcctgccgatgcaaagggcggcgtgcgcctcgccaagtctgtcgaggaagtggtt
gccaatgcgaaggaaatgctgggcaacacgctcgtcaccaagcagaccggcgaagccggc
aagcaggtcaaccgtctctacattgaagatggcgccgatatcgagcgtgagctttatctc
tccatcctgatcgaccgcagcgttggccgtccggcctttgtcgtttcgaccgaaggcggc
atggatattgaagccgttgccgaagaaacccctgaaaagatcgtcaccgtcgccatcgac
ccggccaagggcgtgaccgacgaagatgccaacaagcttgccgatgcgctgaagcttgaa
ggtggagcccgcgaggacggcctgaagctgttcccgatcctttacaaggctttcaccgag
aaggacatgagcctcctcgaaatcaatccgctgatcgtcatgacgaacggtcgcgtgcgc
gttctcgatgccaaggtttcgttcgacaacaacgccctgttccgtcacccggacattgtt
gaactgcgcgacctgacggaagaagatccgaaggaaatcgaagcctccaaatatgacctg
gcctatgtcgccctcgatggcaatatcggctgcatggtcaatggcgccggccttgccatg
gcgacgatggacatcatcaagctctatggcgcagaacctgccaacttcctcgatgttggc
ggcggcgcttccaaggagaaggtgacggctgcgttcaagatcatcaccgccgatccggct
gtcgaaggcattctggtcaacattttcggcggcatcatgaagtgcgatgtcattgccgaa
ggcgtgatcgccgcggtcaaggaagtcggcctcaaggttccgctggttgtccgtctcgaa
ggcaccaatgtcgagcttggcaagaagatcatcaacgagagcggcctgaacgtcatttcg
gccgacgatctcgacgatgcggcgcagaagatcgtcgctgcagtgaaggggaattaa

DBGET integrated database retrieval system