KEGG   Brucella melitensis M5-90: BM590_B0693Help
Entry
BM590_B0693       CDS       T01849                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
bmg  Brucella melitensis M5-90
Pathway
bmg00260  Glycine, serine and threonine metabolism
bmg00630  Glyoxylate and dicarboxylate metabolism
bmg00670  One carbon pool by folate
bmg01100  Metabolic pathways
bmg01110  Biosynthesis of secondary metabolites
bmg01130  Biosynthesis of antibiotics
bmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BM590_B0693 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BM590_B0693 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BM590_B0693 (gcvT)
Enzymes [BR:bmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BM590_B0693 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ADZ88810
Position
II:complement(691437..692540)
Genome map
AA seq 367 aa AA seqDB search
MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPTTYPLGVMKEHLHTRDHAGLFDISHMKL
VEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLDDLIVTRLGEDRFMVVANA
GNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAEAVITDAGLPGADLAFMSGFEPKQ
SWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVEWIGLAARDSLRLEAGLCLHGQD
ITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAIAKGASAKRVGLKPEGRQPVRAGAD
LFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASLATPGTRVFADVRGNKVPVDVHALPFT
PHRYRKG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggcgataccgcacatttgaataccctgccgttgcaggatctgcatgaaaaggctggc
gcgcgcttcggcggctttgccggctggaacatgccaaccacctatccgctgggtgtgatg
aaggaacatcttcatacgcgcgaccatgcgggcctcttcgacatttcccacatgaagctg
gtggaagtttccggcgcggatgccgccgcgcttctcgccgagacctgcccgctcgatccg
acgatcctgaagacgggccagtcgaaatatacgttcttcctcaatgataatggcggcgtg
ctggatgatctcatcgtcacgcgccttggcgaagaccgtttcatggttgttgccaatgcg
ggcaatgccgatgccgacatcgagcatctcaatgaagccgcgtcgggcaaggccgtaaag
gttaatccgctcgaccgtgttttccttgctttgcaggggccggaagcagaagctgtcatc
accgatgccggtctgccgggcgccgatcttgccttcatgagcggtttcgagccgaaacag
agctggttcatgacccgttcgggctataccggcgaagacggtttcgagattggcctgcct
gccgatgaagcccgtgcgctggccgaaaagcttcttgccgatgaacgtgtcgaatggatc
ggccttgccgcccgcgattccttacgcctcgaagcgggcctctgcctgcacggtcaggac
atcacgccggaaaccgatccggtttcggctggcctcacctgggcgatcaccaaggctgtg
cgcgaaaaagccgccttcaacggcgcgaaagccgttctcgacgccattgccaaaggcgcc
agcgccaagcgcgtcggcctcaagccggaaggccgccagccggtgcgcgccggggccgac
cttttcgacgaaagtggccgccagatcggcaccgtcacctcgggcggctttggcccttcc
gccggtttcccggtcgccatgggctatgtcgaggcaagcctcgccacccccggcacccgt
gtttttgcagatgttcgcggcaacaaggttcccgttgacgtccacgcacttcccttcaca
ccgcatcgctatcgcaaaggatga

DBGET integrated database retrieval system