KEGG   Brucella melitensis M5-90: BM590_B1054Help
Entry
BM590_B1054       CDS       T01849                                 

Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bmg  Brucella melitensis M5-90
Pathway
bmg00860  Porphyrin and chlorophyll metabolism
bmg01100  Metabolic pathways
bmg01110  Biosynthesis of secondary metabolites
bmg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BM590_B1054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmg01007]
    BM590_B1054
Enzymes [BR:bmg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BM590_B1054
Amino acid related enzymes [BR:bmg01007]
 Aminotransferase (transaminase)
  Class III
   BM590_B1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADZ89171
Position
II:complement(1041592..1042827)
Genome map
AA seq 411 aa AA seqDB search
MNTHSVPVTTMDAQLRERAERVIPNGMWGHQRASSLPQGYPQYFASGKDACVTDVDGNSY
IDFMCAWGPIILGHRNPLVDAAALSQIELGDSLNGPTAHAVELAELLVATIPHADWALFQ
KNGTDATTSCVTIARGTTKRRKVLVAKGAYHGAAPWCTPSLVGVTAEDRVHLIHYVYNDV
ESLTAAAREAGDDLAAILVSAFKHDLAIPQESPTKEFAQAARALCDAAGAALILDDVRGG
FRIDLGGSWRGTGIEPDMAAYSKAIANGYALAAVTGSDRFREAARQAYMTGSFWYGGASM
AAAVATIKELRRIDGPALMKHAGERLRSGLDAQAARYGFDLLQTGPAVMPLVQFAGDSDA
ALGARFCQEALKRGVYLHHKHNMFISCAHTDDVIDDALSRTEDAFKAISTK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcattcagttccagtcacaacgatggacgcacaattgcgggagcgcgcagag
cgcgtcattcccaacggcatgtggggacatcagcgggcttcatcgcttccgcagggctat
ccgcaatatttcgccagcggcaaggatgcttgcgtcacggacgtcgacggcaacagctat
atcgatttcatgtgcgcctgggggccgatcatcctgggccatcgcaatccgctggtcgat
gcggcagcgctgtctcagattgagcttggcgacagcttgaacggcccaaccgcccatgcc
gtggagctggccgaacttctggtcgccaccataccccatgccgactgggccctgttccag
aagaacggaaccgacgccaccacaagctgcgtcaccattgcgcgcggcaccacgaaacgc
cgcaaggtcctggtggccaaaggcgcctatcatggcgcagcgccctggtgcaccccctcg
ctggttggcgtcaccgccgaggatcgcgtccacctcattcattatgtctataacgatgtc
gaaagcctcaccgcagcggcgcgcgaagccggtgacgatctggcggcaatcctcgtttcg
gcattcaagcacgatctcgccattccgcaggaatcgccaacgaaggaatttgcgcaagcc
gcaagggcgctttgcgatgcggcaggcgcggcgctcattctcgatgacgttcgcggcggg
ttccgtatcgacctcggcggaagttggcgcggcacaggtatcgaaccggacatggccgcc
tattcgaaggctatcgcgaatggttatgccctggcggcagtgaccggaagcgaccgtttc
cgcgaagcggcgcgacaggcctatatgacgggctctttctggtatggcggcgcgtcgatg
gccgcagcggttgcgaccatcaaggaattgcggcgcatcgatggccccgcgctcatgaaa
catgcgggcgaacgccttcgcagcggccttgacgcgcaggccgcccgatacgggttcgac
ctgcttcaaaccggcccggcggtcatgccgctggtgcagttcgccggcgacagcgatgcc
gcgcttggcgcgcgtttttgccaggaggcgttgaagcggggcgtctatctgcaccacaag
cacaacatgttcatctcctgtgcacacaccgatgacgtgatcgacgacgcactctccaga
acagaggacgctttcaaggctatttccaccaaatag

DBGET integrated database retrieval system