KEGG   Bacillus megaterium WSH-002: BMWSH_1588Help
Entry
BMWSH_1588        CDS       T01890                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00970  Aminoacyl-tRNA biosynthesis
bmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMWSH_1588
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmh03029]
    BMWSH_1588
Enzymes [BR:bmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BMWSH_1588
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BMWSH_1588
Mitochondrial biogenesis [BR:bmh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BMWSH_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEN88470
Position
1573507..1574901
Genome map
AA seq 464 aa AA seqDB search
MMIKELTKMNIDEVSPLIEQKKLSPTELVKHTLEKISNENSNTNSFITVCSEKALKAAED
LEKELVEGNVRSKLHGVPIALKDLIFTKGIRTTMGSKLYKDFIPDTNATIVEKLENAGAI
IIGKVNTHEFAYGPTGDRSYFGSCLNPYDSSKITGGSSSGSAASVGAGLVNLSVGTDTGG
SIRIPSSACGTVGMKPTFGLVSKKDVHALSYTQDHVGPITRTVKENALLLNVLAGYDPND
PYSLNMEIQDYSSLIGTDVKGMVIGIPSFYLQSLEEEVHQMFSKCIKVCEYLGAKVTEVN
IDDIGEISHAQSITVQFEASSIHAQTLKNHQKSIDSEVYERLKASRLVKAYEYVHAQSKK
QELIYKYNQVFDHVDILLTPTLPIVPPNIGQREVTINGKVESVRNALLRLTAPTNFTGNP
SLSLPVELSKDGLPIGLQLISRHGMEAKIYQFAYMLEQHVNFAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttgatgattaaggagttaacgaagatgaatattgatgaggtatcaccattaattgaacaa
aaaaaactatctcctactgagttggtaaaacatacgttagagaagatatctaatgagaat
agcaacactaattcttttattactgtatgtagtgaaaaagctctcaaagcagctgaagat
ttagaaaaagaactggtagaaggaaatgtaaggagtaaattacatggagttcctattgcg
ttaaaggacttaatctttacaaaaggcatcagaacaacaatgggttcaaaactttacaaa
gattttatacctgatacaaatgctacgatagtagaaaagcttgaaaatgctggtgccatc
atcataggaaaagtgaatacacatgagtttgcttatggacctacgggcgaccgttcatat
tttggatcgtgtcttaacccttatgactcatcgaagattactggtggatcaagtagtggg
tctgcagcttctgtaggcgccggtttagttaatctttctgtaggaacggatacaggtgga
tctatcagaataccatcatcagcttgtggaacagtaggcatgaaacctacttttggtcta
gttagtaaaaaagatgtccatgctttgtcatatactcaggatcatgttggtcctataact
agaactgtaaaagagaatgctttgctgttaaatgttctagcaggatatgatccaaatgat
ccttattctttaaatatggaaattcaagattacagctctttaattggaacggatgttaag
gggatggtaattggtattccttctttttatttacagagcttagaagaagaagtccatcaa
atgtttagcaaatgtattaaggtatgtgagtatctaggtgcaaaggtaacagaagttaat
atagatgatattggcgagatttctcacgcccaatctataacagtccaatttgaagcttca
tctatacatgcgcaaacattaaaaaaccatcaaaaaagcattgattctgaagtatatgaa
aggctaaaagctagccgactagtaaaagcctatgaatatgtacatgcgcaatcaaaaaaa
caagaattaatttataaatataatcaggtctttgatcatgtagatatcctattaacacct
actttgccaatagttccacctaatattgggcaaagagaagttacgatcaacggaaaagtg
gagtctgttcgaaacgctttgttacgcttgacagcgccgactaattttacaggaaacccc
tctttatctctacctgttgaactgtcaaaagacgggttgcctataggtctacaacttatt
tctaggcacggtatggaagcaaaaatttatcaatttgcttatatgctagagcaacatgtc
aactttgcaaaataa

DBGET integrated database retrieval system