KEGG   Bacillus megaterium WSH-002: BMWSH_2086Help
Entry
BMWSH_2086        CDS       T01890                                 

Gene name
ytsJ
Definition
(GenBank) Malate dehydrogenase, Phosphate acetyltransferase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00620  Pyruvate metabolism
bmh01200  Carbon metabolism
bmh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMWSH_2086 (ytsJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMWSH_2086 (ytsJ)
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     BMWSH_2086 (ytsJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog Shikimate_DH FAD_binding_3 AdoHcyase_NAD ThiF
Motif
Other DBs
NCBI-ProteinID: AEN88968
Position
1969860..1971092
Genome map
AA seq 410 aa AA seqDB search
MSLRDQALHMHQEKQGKLEVKSKVEVQNAQDLSLAYSPGVAEPCKEIHEHPETVYDYTMK
GNMVGVVTNGTAVLGLGNIGPAASLPVMEGKAILFKSFAGVDAFPIALDTTDTDKIVETV
KLMAHTFGGINLEDIAAPQCFEIEERLKKEVDIPVFHDDQHGTAIVTVAGLVNALKIVNK
SMEDLKIVLNGAGAAGIAITKLLYSYGVRDMIMCDTRGAIYEGRPQGMNKVKAEVASYTN
VNKESGTLSDVIKGADVFIGVSAADALSQEMVKSMNEDAIIFAMANPNPEIKPDAAKEAG
AAVIGTGRSDFPNQVNNVLAFPGIFRGALDVRATHINEEMKKAAVEAIAALITEEELNAD
YVIPGPFDPRVAPAVAESVAKAAMDSGVARITIDPARVKTHTEQLTKIEN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacgtgatcaagcactacatatgcatcaagaaaaacaaggtaagttagaagtt
aaatcaaaagttgaagttcaaaacgctcaagatttaagcttagcttactctccaggagta
gcagaaccttgtaaagaaattcatgaacatccagaaacggtgtatgattacacaatgaaa
ggaaacatggtcggcgttgtgacaaatggtacggctgtccttggccttggaaacatcgga
cctgcagcttcacttcctgttatggaaggaaaagcaattttatttaaaagctttgcaggc
gtagacgcattcccaattgcacttgatacaacagatacagataaaattgttgaaactgtg
aaattaatggctcacacattcggaggcattaacttagaagatatcgcagctccacagtgt
tttgaaattgaagagcgcttgaaaaaagaagtagatattcctgtattccatgatgatcag
cacggtacagcaatcgtaacggtagcaggacttgtaaatgcactgaaaattgttaacaaa
tcaatggaagacttaaaaatcgtcttaaacggagcaggagctgccggcattgccattaca
aagcttctttattcttacggcgtacgtgacatgattatgtgtgatacaagaggtgctatt
tatgaaggacgccctcaaggtatgaacaaagtaaaagcggaagtggcttcttatacgaat
gtaaacaaagaaagcggtacgctaagcgatgtaattaaaggcgcagatgtatttatcggc
gtatctgcagcagatgcattatctcaagagatggttaaatcaatgaatgaagatgcaatt
atctttgcgatggcaaaccctaatccagaaatcaagccggacgctgcaaaagaagcagga
gctgctgttattggaacaggtcgttcagacttccctaaccaagtaaataatgttcttgca
ttccctggaattttccgcggtgctctagacgttcgcgctactcacattaacgaagaaatg
aaaaaagctgctgttgaagcaattgcagcgcttattacagaagaagagctaaacgcagat
tacgttattcctggaccatttgatcctcgcgtagcgccagctgtagcagagtctgtagca
aaagcggcaatggattcaggcgttgcccgtattacaattgatccagcacgtgtaaaaaca
catacagaacaattaacaaaaatcgaaaactaa

DBGET integrated database retrieval system