KEGG   Bacillus megaterium WSH-002: BMWSH_2466
Entry
BMWSH_2466        CDS       T01890                                 

Gene name
mqo
Definition
(GenBank) Malate dehydrogenase (Acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00020  Citrate cycle (TCA cycle)
bmh00620  Pyruvate metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01120  Microbial metabolism in diverse environments
bmh01200  Carbon metabolism
Module
bmh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMWSH_2466 (mqo)
   00620 Pyruvate metabolism
    BMWSH_2466 (mqo)
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BMWSH_2466 (mqo)
SSDB
Motif
Pfam: Mqo DAO Pyr_redox HI0933_like Pyr_redox_2 TPP_enzyme_M
Other DBs
NCBI-ProteinID: AEN89348
Position
2314505..2316022
AA seq 505 aa
MRKVIMSNVQKKTDVILIGAGVMSATLGSLLKELAPEWDIKVFEKLADAGEESSNEWNNA
GTGHSALCELNYTSEKADGSIDITKAIRINEQFQLSRQFWSYLVSSKLIRNPQDFIMPIP
HMSLVQGEKNVSFLKKRFEALSNNPLFQGMEYSDSPDKLKEWIPLIMKGRTSNEPIAATK
IDSGTDVNFGALTRMLFDHLKNKGVHVHYKRSVKDIKRKSDGMWEVKVADVDSGKVEYHT
AKFVFIGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCNNPEVIAQHHGKVYGKAKVGA
PPMSVPHLDTRYIDNKKTLLFGPFAGFSPKFLKTGSNLDLISSVKPNNILTMLAAGVKEM
ALTKYLIQQVLLSNEKRVEELREFIPNAKTEDWDIVVAGQRVQVIKDTEAGGKGTLQFGT
EVVSAADGSVAALLGASPGASTAVHVMLEVLEKCFPENMNKWEPKIKEMIPSYGMSLVDH
PDFFNEIHASTSQTLGLIKKESVYS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaggaaggttataatgagcaacgtacagaaaaaaacagacgttatcttaattggtgcc
ggagtcatgagcgcaactttgggatcattactcaaagagttagcacctgaatgggacatt
aaagtatttgaaaaactcgcagacgcaggggaagaaagctcgaacgaatggaataatgca
gggacgggccattctgcgctgtgcgaactaaactatacatcagaaaaagctgatggatct
atagatataacgaaagcgatccgaattaacgagcagtttcagctgtcaagacagttttgg
tcttatcttgtaagcagcaagttgattcgcaatccgcaagattttatcatgccaattccg
catatgagtttggtacaaggggaaaaaaatgtatcgtttctgaaaaagcgttttgaagcg
ctgtcaaacaatccgttgtttcaaggaatggagtattccgacagtcctgacaaactaaaa
gaatggattccgttaatcatgaaggggcgcacgtcaaatgaaccgattgccgcaactaaa
attgattcgggaacagacgtaaactttggtgctttaacacgcatgttgtttgaccacctg
aagaataaaggggttcacgttcattacaaacgaagtgtaaaagatattaaacgtaaaagt
gacggtatgtgggaagtaaaagtcgcagatgtagacagcggcaaagttgagtaccacacg
gcaaaattcgtctttatcggaggtggaggcggaagcttgcctttacttcaaaaaacaggt
attcctgaatccaagcatattggaggattcccagtaagcggattatttatggtatgcaat
aaccctgaagtgattgcgcagcatcacggaaaagtatatggaaaagccaaagtcggagct
ccgccaatgtcggttccgcaccttgatacacgctatattgacaacaaaaagacgctgttg
tttggtccatttgccggcttttcaccaaaattcttaaaaacaggttcgaacttggattta
atcagttctgtaaagccgaataatattttaaccatgctagcagcaggcgtcaaagaaatg
gcgttaacaaaatatttaattcagcaagtgctgttatcaaatgaaaaacgtgtggaagaa
ctgcgtgagtttatcccgaacgctaaaaccgaagactgggatatcgtcgtagcaggccag
cgtgtgcaggtaatcaaagacacggaagccggaggaaaaggaacgcttcagtttggtaca
gaagttgtaagtgccgctgatggttctgttgctgcacttcttggggcttctcctggtgcg
tcaacggcggttcacgttatgctagaagtattggaaaaatgcttcccagaaaacatgaac
aagtgggagccaaaaataaaagaaatgattccttcctacggcatgtcattagttgatcat
ccagacttctttaacgaaattcatgcgtctacttcacagacgcttggtttaattaaaaaa
gaatccgtttatagctaa

DBGET integrated database retrieval system