KEGG   Bacillus megaterium WSH-002: BMWSH_2466Help
Entry
BMWSH_2466        CDS       T01890                                 

Gene name
mqo
Definition
(GenBank) Malate dehydrogenase (Acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00020  Citrate cycle (TCA cycle)
bmh00620  Pyruvate metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01120  Microbial metabolism in diverse environments
bmh01130  Biosynthesis of antibiotics
bmh01200  Carbon metabolism
Module
bmh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMWSH_2466 (mqo)
   00620 Pyruvate metabolism
    BMWSH_2466 (mqo)
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BMWSH_2466 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox Pyr_redox_2 HI0933_like TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AEN89348
Position
2314505..2316022
Genome map
AA seq 505 aa AA seqDB search
MRKVIMSNVQKKTDVILIGAGVMSATLGSLLKELAPEWDIKVFEKLADAGEESSNEWNNA
GTGHSALCELNYTSEKADGSIDITKAIRINEQFQLSRQFWSYLVSSKLIRNPQDFIMPIP
HMSLVQGEKNVSFLKKRFEALSNNPLFQGMEYSDSPDKLKEWIPLIMKGRTSNEPIAATK
IDSGTDVNFGALTRMLFDHLKNKGVHVHYKRSVKDIKRKSDGMWEVKVADVDSGKVEYHT
AKFVFIGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCNNPEVIAQHHGKVYGKAKVGA
PPMSVPHLDTRYIDNKKTLLFGPFAGFSPKFLKTGSNLDLISSVKPNNILTMLAAGVKEM
ALTKYLIQQVLLSNEKRVEELREFIPNAKTEDWDIVVAGQRVQVIKDTEAGGKGTLQFGT
EVVSAADGSVAALLGASPGASTAVHVMLEVLEKCFPENMNKWEPKIKEMIPSYGMSLVDH
PDFFNEIHASTSQTLGLIKKESVYS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggttataatgagcaacgtacagaaaaaaacagacgttatcttaattggtgcc
ggagtcatgagcgcaactttgggatcattactcaaagagttagcacctgaatgggacatt
aaagtatttgaaaaactcgcagacgcaggggaagaaagctcgaacgaatggaataatgca
gggacgggccattctgcgctgtgcgaactaaactatacatcagaaaaagctgatggatct
atagatataacgaaagcgatccgaattaacgagcagtttcagctgtcaagacagttttgg
tcttatcttgtaagcagcaagttgattcgcaatccgcaagattttatcatgccaattccg
catatgagtttggtacaaggggaaaaaaatgtatcgtttctgaaaaagcgttttgaagcg
ctgtcaaacaatccgttgtttcaaggaatggagtattccgacagtcctgacaaactaaaa
gaatggattccgttaatcatgaaggggcgcacgtcaaatgaaccgattgccgcaactaaa
attgattcgggaacagacgtaaactttggtgctttaacacgcatgttgtttgaccacctg
aagaataaaggggttcacgttcattacaaacgaagtgtaaaagatattaaacgtaaaagt
gacggtatgtgggaagtaaaagtcgcagatgtagacagcggcaaagttgagtaccacacg
gcaaaattcgtctttatcggaggtggaggcggaagcttgcctttacttcaaaaaacaggt
attcctgaatccaagcatattggaggattcccagtaagcggattatttatggtatgcaat
aaccctgaagtgattgcgcagcatcacggaaaagtatatggaaaagccaaagtcggagct
ccgccaatgtcggttccgcaccttgatacacgctatattgacaacaaaaagacgctgttg
tttggtccatttgccggcttttcaccaaaattcttaaaaacaggttcgaacttggattta
atcagttctgtaaagccgaataatattttaaccatgctagcagcaggcgtcaaagaaatg
gcgttaacaaaatatttaattcagcaagtgctgttatcaaatgaaaaacgtgtggaagaa
ctgcgtgagtttatcccgaacgctaaaaccgaagactgggatatcgtcgtagcaggccag
cgtgtgcaggtaatcaaagacacggaagccggaggaaaaggaacgcttcagtttggtaca
gaagttgtaagtgccgctgatggttctgttgctgcacttcttggggcttctcctggtgcg
tcaacggcggttcacgttatgctagaagtattggaaaaatgcttcccagaaaacatgaac
aagtgggagccaaaaataaaagaaatgattccttcctacggcatgtcattagttgatcat
ccagacttctttaacgaaattcatgcgtctacttcacagacgcttggtttaattaaaaaa
gaatccgtttatagctaa

DBGET integrated database retrieval system