KEGG   Bacillus megaterium WSH-002: BMWSH_2863Help
Entry
BMWSH_2863        CDS       T01890                                 

Gene name
paaJ
Definition
(GenBank) Thiolase (Acetyl-CoA acetyltransferase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00071  Fatty acid degradation
bmh00072  Synthesis and degradation of ketone bodies
bmh00280  Valine, leucine and isoleucine degradation
bmh00310  Lysine degradation
bmh00362  Benzoate degradation
bmh00380  Tryptophan metabolism
bmh00620  Pyruvate metabolism
bmh00630  Glyoxylate and dicarboxylate metabolism
bmh00640  Propanoate metabolism
bmh00650  Butanoate metabolism
bmh00900  Terpenoid backbone biosynthesis
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01120  Microbial metabolism in diverse environments
bmh01130  Biosynthesis of antibiotics
bmh01200  Carbon metabolism
bmh01212  Fatty acid metabolism
bmh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMWSH_2863 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    BMWSH_2863 (paaJ)
   00640 Propanoate metabolism
    BMWSH_2863 (paaJ)
   00650 Butanoate metabolism
    BMWSH_2863 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMWSH_2863 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    BMWSH_2863 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMWSH_2863 (paaJ)
   00310 Lysine degradation
    BMWSH_2863 (paaJ)
   00380 Tryptophan metabolism
    BMWSH_2863 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMWSH_2863 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMWSH_2863 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMWSH_2863 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmh04147]
    BMWSH_2863 (paaJ)
Enzymes [BR:bmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMWSH_2863 (paaJ)
Exosome [BR:bmh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMWSH_2863 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEN89745
UniProt: G2RM59
Position
complement(2688994..2690184)
Genome map
AA seq 396 aa AA seqDB search
MAVIVNAFRTPIGKFGGSLADTLPEELVSLVMKNNLSSAGYTSEIIDEIIVGQTKQSAHA
PNIARVAGLKAQFSERIPAYTVHRQCGSGMQAVMNGAMSILSGQAEVVLAGGAESMSQAP
HYTVGTRFGFHVGDLTLYDSNTESQPKSQPETLYGTFTMGQTAEWLAEKYSISRTEQDEF
AFYSQEKARRAIELDLFEEEIIPVPVKEGKKGMRHFATDEFPRLTSKEKLGALKPVFQKN
GTVTAGNSSGRNDGASMMLLMSEEKAEQLGLTPMAKIVSFAAAGVSPKEMGIGPVSASQI
ALNKVGLSLGDMDLIELNEAFAAQSIACLREWDITSEKVNVNGGAIALGHPLGCSGARII
TTLCHELHKQKRRYGLATICVAGGLGMAMVVERWTK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgattgtaaatgcatttcgaacgcctattggaaagtttgggggttcgcttgca
gatacgcttccagaagaactagtctctcttgtgatgaaaaacaatttgtcttcagcggga
tatacttcagagattattgatgaaatcattgtcggacagacgaaacaaagcgctcatgct
cctaatatagcgagagtagccgggctgaaagctcaattctctgaacgtattccagcttat
accgtgcaccgccagtgcggttcaggcatgcaggctgtaatgaatggagctatgtccatt
ttgtcgggtcaagccgaagtggtattagccggaggagcggaaagcatgtctcaagcaccg
cactatacggtaggcactcgttttggttttcacgttggtgatttaacactctatgactct
aatacagaaagtcagccaaaatcacagcctgaaacgttatacggaacgtttacgatggga
cagacggccgagtggctcgctgaaaaatatagtattagccgcacggaacaagatgagttt
gctttttatagtcaggaaaaagctaggcgggctatagaactggatttgtttgaagaagaa
attatcccggtacctgtaaaagaaggaaaaaaaggtatgaggcattttgcaacagatgaa
tttcctcgtcttactagcaaagaaaagcttggtgcgcttaagcctgtttttcaaaagaat
ggaacggtgacagccggcaattcatccggcagaaacgatggcgcttcaatgatgctgttg
atgtcggaagaaaaagctgagcagcttggattaacgcctatggcaaagattgtgtcgttt
gccgcagcgggcgtctctccaaaggaaatgggaattggccccgtttctgcttcgcaaatt
gctttaaataaagtcggtttaagcttaggtgatatggacttgattgaattaaacgaagca
tttgccgctcaaagtattgcttgcttaagagaatgggacatcacatcagaaaaagtgaat
gtaaacggaggagcaattgcgcttggacaccctttaggctgctccggagcaagaatcata
acaactctgtgtcatgaactccacaagcaaaaaagacgatacggcctggctactatttgc
gttgcaggaggattaggaatggcgatggtggtggaaagatggacgaaataa

DBGET integrated database retrieval system