KEGG   Bacillus megaterium WSH-002: BMWSH_2951Help
Entry
BMWSH_2951        CDS       T01890                                 

Gene name
proJ
Definition
(GenBank) Glutamate 5-kinase 2
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00330  Arginine and proline metabolism
bmh00332  Carbapenem biosynthesis
bmh01100  Metabolic pathways
bmh01130  Biosynthesis of antibiotics
bmh01230  Biosynthesis of amino acids
Module
bmh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMWSH_2951 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BMWSH_2951 (proJ)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BMWSH_2951 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ADIP
Motif
Other DBs
NCBI-ProteinID: AEN89833
UniProt: G2RN98
Position
complement(2763503..2764609)
Genome map
AA seq 368 aa AA seqDB search
MSPDNKKRVVIKIGSSSLTSSHGEISRRKLERLVDQVVDLKDSGHEVLLVSSGAVAAGYR
KLGCLERPSSLPEKQAAASIGQGLLMEAYSELFLSHGYVASQILITRDDFSDENRYNNAR
NTINVLLERGIVPIVNENDTVTINRLKFGDNDTLSAKVAGLVDSDLLIILSDIDGLYSAD
PRQDPNAKLVPHVGEITQEIEESAGDSGSSVGTGGMRSKIDAFKIAMASGIPAFLGRAGV
PNILTQAVDGDATGTYFESEDDSANLNQKKQWIAFNSGPEGEIVVEDAAKRAIIEDKEPL
LREHVKYIKGHFSERAVVRILDKEENELALGVTNYSSDELALNEPIDQPIVDSEGLVCHL
EIPVPVGL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtcccgacaataagaagcgggttgtaattaaaattggaagtagttcattaacaagt
tcacacggtgaaatcagcagaaggaagctcgagcgccttgtggatcaagtcgtagactta
aaagacagcggtcatgaagtgctattggtttcatcaggagctgtagctgcaggataccga
aagctcggctgcttagagcgacctagctctttacctgaaaaacaagcagctgcctcaatc
ggtcaaggactgttaatggaggcttattcggaactgttcctatcacacggatacgttgct
tctcaaatcttaattacaagagacgatttttcagacgaaaatcgttacaacaatgcacga
aatacaatcaacgtgctgttagaacgcggcattgtgccaattgtcaatgaaaacgacacg
gtaaccatcaatcgattaaaatttggcgataatgatacactttcagctaaagttgctgga
ctagtggattccgacctgcttattattttatcggatatcgatggcttatacagcgcggac
cctcgccaggatccaaatgcaaaattagtccctcacgtaggggaaatcacgcaagaaatc
gaagaatctgcaggagattcaggaagttcagttggaacaggcggtatgcgctcgaaaatt
gacgcgttcaaaatcgctatggcgtcaggaattccagcatttttaggaagagctggtgtg
ccaaacattttaacacaagcggttgacggagatgcaacaggaacgtattttgaatctgaa
gatgattctgcgaaccttaatcagaaaaagcagtggattgcgtttaactctggtcctgaa
ggggaaatagtagtcgaagatgccgcgaaacgtgcaattattgaagataaagagccttta
cttcgcgagcatgttaaatatattaaaggccactttagtgaacgagcagttgtacgtatt
ctagataaagaagaaaatgagctggctctgggcgtgacaaattattcatctgatgaactt
gcactgaatgagccaattgatcaaccgattgtagacagcgaaggtctagtgtgtcactta
gaaattccagtaccggtcggtttgtaa

DBGET integrated database retrieval system