KEGG   Bacillus megaterium WSH-002: BMWSH_3486Help
Entry
BMWSH_3486        CDS       T01890                                 

Definition
(GenBank) Pyruvate carboxyltransferase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00360  Phenylalanine metabolism
bmh00362  Benzoate degradation
bmh00621  Dioxin degradation
bmh00622  Xylene degradation
bmh01100  Metabolic pathways
bmh01120  Microbial metabolism in diverse environments
bmh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BMWSH_3486
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMWSH_3486
   00622 Xylene degradation
    BMWSH_3486
   00621 Dioxin degradation
    BMWSH_3486
Enzymes [BR:bmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BMWSH_3486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AEN90368
Position
3270991..3271950
Genome map
AA seq 319 aa AA seqDB search
MEHNSKIIDCTIRDGGLINNWDFSVEFVQDLYNGLSAAGVEYMEIGYKNSPKLLQATEPN
PWRFLDDNFLKEIIPEKKFTKLSALVDIGRVDSNDILPREQSMLDMIRVACYIREVDKGL
ELIKMFHDLGYETSLNIMALSSVPENQLIEAFEMVKKSPVDVVYIVDSFGSLDPADIEHQ
VKKFQAMIPSKQLGIHTHNNMQLAFANTLTAMRNGVTFLDSSVYGMGRAAGNCNTELLVS
YIPKPSYEMKPILGVIEKHMLEMRQKWEWGYIIPYMISGVLNEHPRVAMAYRDSEDRDKF
VDFYDKVTSPEVTTSPASK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatagcaaaattatagactgtaccattcgtgacggaggtttaattaataat
tgggattttagcgttgaatttgtgcaagacttatataacggcctaagcgcagccggcgtt
gaatatatggagattggttataaaaattcccctaagcttcttcaagcgactgagcccaac
ccatggagatttcttgacgataactttctcaaagaaattatccctgagaaaaagttcacg
aagctatctgccttagtagatattgggcgtgtagattcaaatgacatcctgccccgtgaa
caaagtatgttagatatgattcgagtggcatgctatattcgcgaagtagataaaggctta
gagcttataaaaatgtttcacgatttgggctatgagacttcacttaacattatggcacta
tctagcgtaccggaaaatcagcttattgaagcatttgaaatggtaaagaaaagccctgta
gatgttgtatatatcgttgactcctttggaagcctagaccctgcggatattgagcatcaa
gtgaaaaagtttcaagccatgattcctagcaaacagcttggaatccatacgcataacaac
atgcagctagcttttgctaatacattaactgctatgcgtaatggagttacattccttgat
tcatctgtttatggtatgggccgtgcagctggtaactgtaacacagagctgcttgttagc
tacataccaaaaccaagctatgagatgaagccgattcttggcgtaattgaaaagcatatg
cttgaaatgcgtcaaaagtgggaatggggctatatcattccttacatgatttctggtgta
ctgaatgaacatccacgtgttgctatggcttaccgtgatagcgaggatcgtgacaaattc
gtagatttttatgacaaagtaacgtctccagaagttactacgtctccagcatcaaaataa

DBGET integrated database retrieval system