KEGG   Bacillus megaterium WSH-002: BMWSH_4190Help
Entry
BMWSH_4190        CDS       T01890                                 

Definition
(GenBank) Glucose 1-dehydrogenase 4
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00030  Pentose phosphate pathway
bmh01100  Metabolic pathways
bmh01120  Microbial metabolism in diverse environments
bmh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMWSH_4190
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BMWSH_4190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AEN91069
Structure
PDB: 

Position
complement(3936970..3937755)
Genome map
AA seq 261 aa AA seqDB search
MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAI
IVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGA
FLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKG
IRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVASVAAFLASSQASYVT
GITLFADGGMTKYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagatttaaaagataaagtagttgtaattacaggtggatcaacaggtttagga
cgcgcaatggctgttcgtttcggtcaagaagaagcaaaagttgttattaactattacaac
aatgaagaagaagctttagatgcgaaaaaagaagtagaagaagcaggcggacaagcaatc
atcgttcaaggcgacgtaacaaaagaagaagacgttgtaaatcttgttcaaacagctatt
aaagaattcggtacattagacgttatgattaacaacgctggtgttgaaaacccagttcct
tctcatgagctatctttagataactggaacaaagttattgatacaaacttaacaggtgca
ttcttaggaagccgtgaagcaattaaatatttcgttgaaaacgacattaaaggaaacgtt
attaacatgtctagtgttcacgaaatgattccttggccattatttgttcactacgcagca
agtaaaggcggtatgaaactaatgacggaaacattggctcttgaatatgcgccaaaaggt
atccgcgtaaataacattggaccaggtgcgatgaacacaccaattaacgcagagaaattt
gcagatcctgtacaacgtgcagacgtagaaagcatgattccaatgggttacatcggtaaa
ccagaagaagtagcatcagttgcagcattcttagcatcatcacaagcaagctatgtaaca
ggtattacattatttgctgatggcggtatgacgaaatatccttctttccaagcaggaaga
ggctaa

DBGET integrated database retrieval system