KEGG   Bacillus megaterium WSH-002: BMWSH_4377Help
Entry
BMWSH_4377        CDS       T01890                                 

Gene name
speB
Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00330  Arginine and proline metabolism
bmh01100  Metabolic pathways
Module
bmh_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMWSH_4377 (speB)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BMWSH_4377 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AEN91256
UniProt: G2RTU0
Position
complement(4129414..4130370)
Genome map
AA seq 318 aa AA seqDB search
MKYPLSPDVKPEFCTTGSFMRLPAERGNAKVGLVGMPFDTAASFRVGARFAPQAIRQASM
TLFPYHPVHDVYPFDDTNAIDIGDVPVIPHNIHRSYELMEEAVGALMDRGIVPIGIGGDH
SVTLASLRAAAKRYGPVAMIHFDSHTDTWDTYYDEKYWHGSPFIRAYEEGLVDPKKVFQI
GIRGTLNHPGDVQESKDLGYHVVTAGELERQGFSMILEQMKTAIGDTPCFLTFDIDFVDP
SCAPGTGTLEVGGFSSRETLQMIRSLTGFNYVGFDLVEVLPSYDPTQITSLLAATIIHDF
ASLVAVKTKRKSLDTTIE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccattgtccccagatgtcaaaccagaattttgtacaacaggctcatttatg
aggcttccagcggaaagaggaaatgcaaaagtagggctagtagggatgccgtttgatacg
gcggcatctttcagagtaggtgcgcgttttgcacctcaagccattcggcaagcttccatg
acgctgtttccttatcacccggtacacgacgtatacccatttgatgatacaaatgccatt
gatattggtgatgtgccggttattccgcataatattcacagaagctatgaattgatggaa
gaagcggtaggagctcttatggatagaggaatcgttccaattggaattggaggagatcat
tccgttactttagcaagccttcgtgctgctgctaaaagatatggcccagtggctatgatt
cattttgattctcatacagatacgtgggatacgtattatgatgaaaaatattggcacgga
tctccttttatacgcgcatatgaagaagggctagtagatccgaagaaagtttttcaaatt
ggtattcgcgggacattaaatcatccgggagatgttcaagaaagcaaagacctcggttac
catgtagtaacggcaggagagcttgaacgtcaggggttttcaatgattttggagcaaatg
aagacagcgattggagatacgccgtgctttttaacatttgatattgattttgttgatcct
tcttgtgcaccaggcacgggaacgcttgaagtaggcggattcagcagcagagaaacgctg
caaatgatccgttctctaacgggatttaactatgttggatttgacctagtagaagtgctg
ccttcttatgatccaactcagataacctctttgcttgcagctacaatcattcatgatttt
gctagtttagttgcagtgaaaacgaaaagaaagtcattggatacgacgattgaataa

DBGET integrated database retrieval system