KEGG   Brucella melitensis ATCC 23457: BMEA_A0692Help
Entry
BMEA_A0692        CDS       T00867                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00860  Porphyrin and chlorophyll metabolism
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMEA_A0692 (hemN)
Enzymes [BR:bmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BMEA_A0692 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ACO00455
UniProt: C0RHZ7
Position
I:666194..667528
Genome map
AA seq 444 aa AA seqDB search
MHDDAIRRYAALAVPRYTSYPTAADFVPVGMDTTRRWLRQIGPEESVSLYIHVPYCSQIC
HYCGCNAKMAIREDVIENFVNALLGEIRTVSASLTARPRVAHLHWGGGTPSILNAGQFQT
VLAAIRTAFDFDLSMEHAIELDPRTVTPLLAKTLAEMGVNRASLGVQDVDSRVQMAIGRV
QPIETVAEATRLLREVGINRINFDLIYGLPLQTVETLRETCERVVTLSPDRVACYGYAHL
PQRRANQRLIDENTLPDADERFRQARIVTDSFIGFGYQPVGIDHFALPDDDLAIAAREGT
LNRNFQGYTNDRCGTLIGFGPSSISQFPGGYAQNISDVGQYRKRVEAGELATVRGYTLRD
ADRIRSAIISALMCNFCVDLNAVAPGMEFSDEFALLRPLVADGLVAVEGRTIRATENGKS
LIRLVAAAFDEFRRDSVHGFSFAV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgacgcgataagacgctacgcagcactggctgttcctcgttatacttcctat
cctactgcggcggatttcgtgccggtcggcatggataccacgcgccgttggctgcgccag
atcgggccggaagaaagcgtttcgctttatatccatgtgccgtattgcagtcagatatgc
cactattgcggctgcaacgcaaaaatggcgatacgtgaggatgtgatcgaaaatttcgta
aatgcgcttcttggagaaatccggactgtgagcgcaagccttacggcgcgtccccgcgtt
gcccatcttcactggggcggcggcacaccctccattctcaatgccgggcaatttcagact
gttctggccgcaatccgcacggcgtttgatttcgatctctcgatggaacacgccatagag
cttgatccacgcacggtaacaccgcttttggcgaagacgcttgccgaaatgggtgtaaat
cgcgcaagcctcggtgtgcaggatgtggacagcagggtgcaaatggccatcggtcgcgtt
cagccgattgaaacggttgccgaggctacaaggctcctgcgtgaggtgggtatcaaccgc
atcaatttcgacctgatctatggtctgcctttgcagacggtcgagacattgcgcgaaacc
tgcgagcgcgttgtgacgctctcaccggatcgggttgcctgctatggctatgcgcatctg
ccgcagcgccgtgcaaatcagcgtctcatcgatgaaaacacgctgcctgacgcggacgag
cgtttccgtcaggcccgcatcgtaacggacagcttcattggtttcggctatcagccggtt
ggtatcgaccattttgcgctgccggatgacgatcttgcgatcgctgcgcgcgaaggcact
ctgaatcgcaattttcagggctataccaacgaccgttgcggaaccctgatcgggtttggc
ccgtcatcgatctcgcagtttccgggcggttatgcgcagaatatttccgatgtcgggcaa
tatcgcaagcgcgtggaagccggcgagctggcgacggttcgcggctacacgctgcgtgac
gcagaccgtatccgctccgccatcatctccgcgctcatgtgcaatttctgcgtcgatctg
aacgcggtcgcgccgggcatggaattttccgacgagtttgcgctgctgcgccctcttgtt
gccgatggtctggtggcggtcgagggccgtacgatccgcgccacggaaaatggcaagtcg
ctgatccgtcttgttgcggcagcttttgatgagtttaggagagatagcgtacacggcttc
agttttgcagtgtga

DBGET integrated database retrieval system