KEGG   Brucella melitensis ATCC 23457: BMEA_A1155Help
Entry
BMEA_A1155        CDS       T00867                                 

Gene name
hflX
Definition
(GenBank) GTP-binding proten HflX
  KO
K03665  GTPase
Organism
bmi  Brucella melitensis ATCC 23457
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bmi03009]
    BMEA_A1155 (hflX)
Ribosome biogenesis [BR:bmi03009]
 Prokaryotic Type
  GTPases
   BMEA_A1155 (hflX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP-bdg_M GTP-bdg_N MMR_HSR1 Dynamin_N FeoB_N RsgA_GTPase ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACO00890
UniProt: C0RJ82
Position
I:complement(1105595..1107013)
Genome map
AA seq 472 aa AA seqDB search
MSKPKDKKAASLDGSKGFALSEPEPTRAAVIVPVLPDRYNSGSAGEDGARSQFQRSNEAR
LEEAIGLARAIGLDIEHAEIAIVTNPRPATLLGAGKAQSIAEVVKEKAIGLVVVDHALTP
VQQRNLEKEWNAKVIDRTGLILEIFGERARTKEGALQVELAHLNYQKGRLVRSWTHLERQ
RGGGGFLGGPGETQIEADRRLLQEKILRIKRELETVVRTRALHRQKRRKVPHPIVALVGY
TNAGKSTLFNRMTGAQVLAEDMLFATLDPTLRRIRLPHGETVILSDTVGFISNLPHHLVA
AFRATLEEVVEADLILHVRDISDPDNAAQAEDVENILAGLGIEPQDHARVVEVWNKIDNL
DESAREAALRLAAAGSEEGRPIPVSAITGEGVDRLLSLIETRIAGALGSVDLVLSPFDLH
LLDWIYQHGSDVQRENLEDGSVRIKARLTEIARRMLDEKRGIRPEKPEIDWE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaaacccaaggataaaaaagcggcatccctcgatggcagcaagggctttgccctt
tccgagcctgagccaacgagagcagccgtcattgttcccgtcctgccggaccgttataat
agcggctctgcgggcgaggatggcgcaagatcgcagttccagcgttccaacgaggcgcgc
cttgaggaagcgatcgggcttgcgcgcgcaattggtcttgatatcgaacatgcggaaatc
gccatcgtcaccaatccgcggcccgcgacgctgcttggtgcgggcaaggcccaatccatt
gccgaagtcgtcaaggaaaaggcgattggactggtggttgtcgatcatgccctgacgccg
gtgcagcagcgcaatcttgaaaaggaatggaacgccaaggtcatcgaccgaaccgggctc
attctggagattttcggtgaacgcgcgcgcaccaaggaaggcgcgcttcaggtggagctg
gcgcatctcaactaccagaagggacgccttgtcagaagctggacccaccttgaacgccag
cgcggcggtgggggcttccttggcggcccgggtgaaacccagatcgaagctgaccgacgc
ctgcttcaggaaaaaatcctgcgcatcaagcgcgagcttgaaaccgtggtgcgcacgcgc
gcgctgcatcgccagaagcggcgcaaggtgccgcatccaattgttgcgcttgtcggctat
accaatgcgggaaaatccacgcttttcaaccgcatgacgggtgcgcaggtgcttgcggaa
gatatgcttttcgccacgctcgatccgaccttgcgccgcatccggcttccccatggcgaa
acggtcatcctgtcggacacggtgggctttatttccaatctgccgcaccatctcgttgcc
gctttccgggcaacgctcgaagaagtggtggaggccgacctgatcctgcatgtccgtgat
atttccgaccccgacaacgcggcgcaggccgaggatgtggagaatattctggctggtctc
ggtatcgagccgcaggaccatgcccgcgtcgtggaggtctggaacaagatcgacaatctc
gacgaaagtgcgcgtgaggcagccttgcgccttgccgccgccggaagcgaggaggggcgc
ccgatccctgtttcggctatcaccggtgaaggcgttgacaggttgctttcgcttatcgaa
acacggatagcaggtgcgcttggatcggtcgatctggtgctttcgcctttcgatctgcat
cttctcgactggatttaccagcacggcagcgatgttcagcgtgaaaaccttgaagacggt
tcggttcgtatcaaggcgcggctgaccgaaatcgcccgcaggatgctggacgaaaagcgc
ggcatccggcctgaaaagcctgagatcgattgggagtag

DBGET integrated database retrieval system