KEGG   Brucella melitensis ATCC 23457: BMEA_A1177Help
Entry
BMEA_A1177        CDS       T00867                                 

Gene name
eno
Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00010  Glycolysis / Gluconeogenesis
bmi00680  Methane metabolism
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01120  Microbial metabolism in diverse environments
bmi01130  Biosynthesis of antibiotics
bmi01200  Carbon metabolism
bmi01230  Biosynthesis of amino acids
bmi03018  RNA degradation
Module
bmi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEA_A1177 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    BMEA_A1177 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BMEA_A1177 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bmi03019]
    BMEA_A1177 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmi04147]
    BMEA_A1177 (eno)
Enzymes [BR:bmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BMEA_A1177 (eno)
Messenger RNA biogenesis [BR:bmi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BMEA_A1177 (eno)
Exosome [BR:bmi04147]
 Exosomal proteins
  Proteins found in most exosomes
   BMEA_A1177 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: ACO00911
UniProt: C0RJA3
Position
I:complement(1128911..1130188)
Genome map
AA seq 425 aa AA seqDB search
MTAIIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLG
KGVEKAVEVVNGKIFDAIAGMDAESQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKA
AAQASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRY
GSEVFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGL
DCAATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTD
LIGNKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTA
VMSHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELDKQARYAGRS
ALKLL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatcatcgacatcgtcggccgcgaaattctcgacagccgcggcaacccgacc
gtcgaagtggatgtcgtgcttgaagatggctctttcggacgcgcggctgttccgtccggc
gcatcgactggcgcgcatgaagccgttgaactgcgtgatggcggcagccgttatcttggc
aagggcgtggaaaaggcagttgaagtagtcaatggcaagattttcgacgccattgcaggc
atggacgcggagagccagcttctcatcgaccagacgctgatcgatcttgatggctcggcc
aacaagggcaacctcggcgccaatgctattctcggcgtttccctggcggttgccaaggcg
gctgcgcaagccagcggcctgccgctttatcgctatgtgggcggcaccaatgcgcatgtg
cttcccgttccgatgatgaacatcatcaatggcggcgcccatgccgataatccgatcgat
tttcaggaattcatgatccttccggttggcgcgacttccattcgcgaagctgtgcgctat
ggctcggaagtcttccacacactgaagaagcgcctcaaggatgccggacataacaccaat
gtcggcgacgaaggcggctttgcgccaaacctcaagaatgcacaggccgcactcgatttc
atcatggaatcgattgagaaggctggtttcaagccgggcgaagatattgctcttggcctg
gactgcgcggcgaccgagttcttcaaggacggcaactacgtctatgaaggcgagcgcaag
acccgcgatccgaaggcgcaggccaagtatctcgccaagcttgccagcgactatcctatc
gtcaccattgaagacggtatggctgaagacgattgggaaggctggaaatatctgaccgat
ctgatcggcaataagtgccagcttgtcggcgacgatctgttcgtgacgaattcggctcgt
ctgcgtgacggtatccgtctgggcgtcgccaactcaattctcgtcaaggtgaaccagatc
ggttcgctgtcggaaacgctggacgcggtcgaaaccgcccacaaggctggttacaccgcc
gttatgtcgcatcgctcgggcgaaacggaagattccaccattgccgatcttgccgtggct
accaattgcggccagatcaaaaccggctcgctcgcgcgttcggatcgcacggcgaagtac
aaccagctcatccgcattgaggaagagctggacaagcaggcccgctatgctggtcgcagt
gcactgaagttgctctaa

DBGET integrated database retrieval system