KEGG   Brucella melitensis ATCC 23457: BMEA_A1736Help
Entry
BMEA_A1736        CDS       T00867                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00230  Purine metabolism
bmi00250  Alanine, aspartate and glutamate metabolism
bmi01100  Metabolic pathways
Module
bmi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMEA_A1736 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMEA_A1736 (purA)
Enzymes [BR:bmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BMEA_A1736 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ACO01419
UniProt: C0REU7
Position
I:complement(1644841..1646130)
Genome map
AA seq 429 aa AA seqDB search
MANVVVVGSQWGDEGKGKIVDWLSERADVIVRYQGGHNAGHTLVIDGVSYKLSLLPSGLV
RGKLSVIGNGVVVDPHHFVAEVEKLRGQGIDVTPDVLRVAENAPLILSIHRELDAMREGS
NSGLKIGTTKRGIGPAYEDKVGRRAIRVIDLTEPETLRPKVERLLAHHNSLRRGMGLEEI
AVETILTELTSVADQILPYIDQVWRVLDERRKAGARILFEGAQGALLDNDHGTYPFVTSS
NTVAGQAAAGSGLGPTAIGYVLGITKAYTTRVGEGPFPTELNDEIGEFLGTKGHEFGVVT
GRKRRCGWFDAVIVRQTVRTSGINGIALTKLDVLDGLEEIKICVAYELDGKRIDYLPSSM
GAQARVKPIYETLPGWSETTAGARSWNDLPAQAVKYVRHIEELIGAPVAMLSTSPEREDT
ILVTDPFHD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtggttgtcgtcgggtcgcaatggggcgacgagggcaagggaaagatcgtt
gactggctgtccgagcgtgccgacgtgatcgtgcgctaccagggcggtcataacgcaggt
catacgcttgtcatcgacggtgtcagctacaagctttcgctgctgccatccggcctcgtg
cgcggcaagttgagcgttatcggcaatggcgtcgtggtcgatccgcaccatttcgtcgcc
gaagttgaaaagctgcgcgggcagggcatcgatgtgacgccggatgtgctgcgcgttgcg
gaaaacgcaccgcttatcctttcgatccatcgtgaactcgacgccatgcgcgaaggctcc
aattcaggcctcaagatcggcacgaccaagcgcggcatcggccccgcttacgaagacaag
gttggccgccgcgccatccgcgtgatcgatctgaccgagccggaaacattgcggccgaag
gtggagcgcctgcttgcgcaccataattcgctgcgccgcggcatgggccttgaagaaatc
gccgttgaaaccatcctcaccgaactgacttcggttgccgaccagatcctgccctatatc
gatcaggtctggcgtgtcctggacgagcgccgcaaggctggcgcccgtatcctgtttgaa
ggtgcgcagggcgcgctgctcgacaatgatcacggcacctatccgttcgtgacctcttcc
aacacggttgccggtcaggccgcggccggttccggcctcggccccacggctatcggctat
gtgcttggcatcaccaaggcctatacaacccgcgttggcgaaggtccgttcccgaccgag
ctcaatgacgagatcggcgaattcctcggcaccaagggccatgaattcggcgtggtgacg
ggccgcaagcgccgttgcggctggttcgatgccgtcatcgtgcgccagacagtgcgcact
tccggcatcaacggtattgcacttaccaagctcgatgttctggatggtctggaagaaatc
aagatttgcgtcgcctatgaactcgacggcaagcgcatcgattatctgccgtcttccatg
ggcgcgcaggcccgcgtgaagccgatctacgaaaccttgccgggctggtctgaaacaacc
gccggtgcgcgttcgtggaacgatcttcccgcgcaggcggtcaaatatgtccgccatatc
gaagagctgatcggtgcgccggtggcgatgctctccacaagccccgagcgcgaggatacg
atcctcgtaaccgatccgttccacgactga

DBGET integrated database retrieval system