KEGG   Brucella melitensis ATCC 23457: BMEA_A1822Help
Entry
BMEA_A1822        CDS       T00867                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00071  Fatty acid degradation
bmi00072  Synthesis and degradation of ketone bodies
bmi00280  Valine, leucine and isoleucine degradation
bmi00310  Lysine degradation
bmi00362  Benzoate degradation
bmi00380  Tryptophan metabolism
bmi00620  Pyruvate metabolism
bmi00630  Glyoxylate and dicarboxylate metabolism
bmi00640  Propanoate metabolism
bmi00650  Butanoate metabolism
bmi00900  Terpenoid backbone biosynthesis
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01120  Microbial metabolism in diverse environments
bmi01130  Biosynthesis of antibiotics
bmi01200  Carbon metabolism
bmi01212  Fatty acid metabolism
bmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMEA_A1822
   00630 Glyoxylate and dicarboxylate metabolism
    BMEA_A1822
   00640 Propanoate metabolism
    BMEA_A1822
   00650 Butanoate metabolism
    BMEA_A1822
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMEA_A1822
   00072 Synthesis and degradation of ketone bodies
    BMEA_A1822
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMEA_A1822
   00310 Lysine degradation
    BMEA_A1822
   00380 Tryptophan metabolism
    BMEA_A1822
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMEA_A1822
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMEA_A1822
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMEA_A1822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmi04147]
    BMEA_A1822
Enzymes [BR:bmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMEA_A1822
Exosome [BR:bmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMEA_A1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACO01499
UniProt: C0RF27
Position
I:complement(1720599..1722113)
Genome map
AA seq 504 aa AA seqDB search
MLRHMLKEERMSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAAD
VDEVILGQVLTAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDA
KIIVAGGQESMSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQW
QLSRSEQDEFALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVL
AKLKPAFDKEGTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIM
GTGPIPATRKALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGH
PIGASGARVLTTLLYEMERRDAKRGLATLCISAAAWAWPFVSSGIDPVLERHLKPTANFG
RVPEEGCFFPAKVNAERKHAGESVLFRLRPMACDCGQIPDVVRTNTENPAISDSSLIRSR
VVPYINRALPPHPSLGKASARIET
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgccacatgcttaaggaggaaagaatgtccgatccgaaatccatcgtcatcgcc
agtgcagcgcgcaccgcggtgggtgcctttaatggcgcctttgccaatgttcctgctcat
gaactgggtgcagtggccatcaaggctgctctggagcgtgctggtgtcgatgcggcggat
gtcgatgaggttattctggggcaggtgctgacggcaggcgaagggcagaatcccgcccgt
caggccgccatgggggccggttgcccgaaggaaaccaccgcttttgccatcaaccagctc
tgcggttccggcctgcgggcggttgcgctcgggatgcagcagattgtttccggcgatgcg
aagattatcgtggcgggcgggcaggaatccatgtccatggcgccgcattgtgcctatctg
cgctccggcgtgaagatgggcgatttcaagatgatcgacaccatgctgaaagacggcctg
accgatgctttccatggctatcacatgggcatcaccgctgaaaatattgcgcgccaatgg
cagttgagccgcagcgagcaggacgagttcgcactcgcctcgcagcacaaagccgaggcc
gcgcagaaggcaggccgcttcgatgaggagatcgtgcctttcaccgtcaaggcccgcaag
ggggatgttgtggtttcggcagatgaatatatccgtccgggcacgacgatggaggtgctg
gccaagctgaagccggcttttgacaaggaaggcacggtgacggcgggcaatgcatccggc
atcaatgacggtgccgcagcggttgtgctgatggatgctggcgaggcagccaggcgtggc
gtgaagcctctggcgcgcatcgtatcctgggcgacggctggcgttgatccgtcgatcatg
ggaaccgggccgatccccgcaacgcggaaggcgctggaaaaggcaggctggagcgttggc
gaccttgatcttgttgaggccaatgaggcctttgcagcgcagtcatgcgcggtggtgcgc
gatctgggtctcaatcctgaaatcgtcaatgtcaatggcggcgcaatcgctatcggccat
ccgatcggcgcctccggcgcccgcgtgctgacgacgctgctctacgaaatggagcgtcgc
gatgccaagcgtggtctggcgacgctttgtatctcggcggcggcatgggcgtggcccttt
gtgtcgagcgggattgatccggttttagaacgtcatctgaaaccaaccgccaatttcggg
cgtgtgccggaagaggggtgtttttttccggcaaaagttaacgcagaacggaaacatgca
ggggaaagcgtgctgtttcggctccgccctatggcgtgtgactgcggccagataccagat
gttgtgagaacaaatacagaaaatccagccatcagcgattcgtcgctgattcgttccaga
gtcgttccatatattaaccgggcgcttccgcctcatccctctcttgggaaggcatctgcc
cgcattgaaacttaa

DBGET integrated database retrieval system