KEGG   Brucella melitensis ATCC 23457: BMEA_A1983Help
Entry
BMEA_A1983        CDS       T00867                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00020  Citrate cycle (TCA cycle)
bmi00640  Propanoate metabolism
bmi00660  C5-Branched dibasic acid metabolism
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01120  Microbial metabolism in diverse environments
bmi01130  Biosynthesis of antibiotics
bmi01200  Carbon metabolism
Module
bmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMEA_A1983
   00640 Propanoate metabolism
    BMEA_A1983
   00660 C5-Branched dibasic acid metabolism
    BMEA_A1983
Enzymes [BR:bmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMEA_A1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACO01643
UniProt: C0RFH1
Position
I:complement(1877318..1878514)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTLPGPLYVVKSQIHAGGRGKGKFK
ELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYL
SILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLE
GGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFRHPDIV
ELRDLTEEDPKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVEGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaagcgcctgcttcacacctacggcgcgccgatcgcc
aatggtgtggctgtctattccgtcgaacaggcggaagaatgggcaaagacgcttcccgga
ccgctttatgtcgtcaagagccagatccatgctggcggacgcggcaagggcaagttcaag
gaactgcctgccgatgcaaagggcggcgtgcgcctcgccaagtctgtcgaggaagtggtt
gccaatgcgaaggaaatgctgggcaacacgctcgtcaccaagcagaccggcgaagccggc
aagcaggtcaaccgtctctacattgaagatggcgccgatatcgagcgtgagctttatctc
tccatcctgatcgaccgcagcgttggccgtccggcctttgtcgtttcgaccgaaggcggc
atggatattgaagccgttgccgaagaaacccctgaaaagatcgtcaccgtcgccatcgac
ccggccaagggcgtgaccgacgaagatgccaacaagcttgccgatgcgctgaagcttgaa
ggtggagcccgcgaggacggcctgaagctgttcccgatcctttacaaggctttcaccgag
aaggacatgagcctcctcgaaatcaatccgctgatcgtcatgacgaacggtcgcgtgcgc
gttctcgatgccaaggtttcgttcgacaacaacgccctgttccgtcacccggacattgtt
gaactgcgcgacctgacggaagaagatccgaaggaaatcgaagcctccaaatatgacctg
gcctatgtcgccctcgatggcaatatcggctgcatggtcaatggcgccggccttgccatg
gcgacgatggacatcatcaagctctatggcgcagaacctgccaacttcctcgatgttggc
ggcggcgcttccaaggagaaggtgacggctgcgttcaagatcatcaccgccgatccggct
gtcgaaggcattctggtcaacattttcggcggcatcatgaagtgcgatgtcattgccgaa
ggcgtgatcgccgcggtcaaggaagtcggcctcaaggttccgctggttgtccgtctcgaa
ggcaccaatgtcgagcttggcaagaagatcatcaacgagagcggcctgaacgtcatttcg
gccgacgatctcgacgatgcggcgcagaagatcgtcgctgcagtgaaggggaattaa

DBGET integrated database retrieval system