KEGG   Brucella melitensis ATCC 23457: BMEA_B0067Help
Entry
BMEA_B0067        CDS       T00867                                 

Definition
(GenBank) TraI protein
  KO
K03202  type IV secretion system protein VirB7
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMEA_B0067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmi02044]
    BMEA_B0067
Secretion system [BR:bmi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BMEA_B0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPAM_1
Motif
Other DBs
NCBI-ProteinID: ACO01948
UniProt: C0RK15
Position
II:complement(60630..60803)
Genome map
AA seq 57 aa AA seqDB search
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtaatccttgcttttgtcgccacggccttccttgccggttgcactacaacg
gggccggccgtggtgccggttctcgatggcaaaccgcgggttcccgtcaacaaaagcgtt
ccggctaaaccgcccctggctcagcctaaccccgttgacacttacgaggactaa

DBGET integrated database retrieval system