KEGG   Brucella melitensis ATCC 23457: BMEA_B0174Help
Entry
BMEA_B0174        CDS       T00867                                 

Definition
(GenBank) Cytochrome c2 precursor
  KO
K08738  cytochrome c
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMEA_B0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CAP_GLY
Motif
Other DBs
NCBI-ProteinID: ACO02047
UniProt: C0RKB4
Position
II:159475..159870
Genome map
AA seq 131 aa AA seqDB search
MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGEGAKNMVGPELNGLFGR
HSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFL
KQYDLGGKIKE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtc
gcgcaaggggcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccat
cagattggtgagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgt
cactcgggttccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtc
tgggatgaggaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagacc
aagatggtctatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctc
aagcagtatgatctgggcggcaagatcaaggaataa

DBGET integrated database retrieval system