KEGG   Brucella melitensis ATCC 23457: BMEA_B0845Help
Entry
BMEA_B0845        CDS       T00867                                 

Definition
(GenBank) Hypothetical protein, conserved
  KO
K21909  D-erythrulose 1-phosphate 3-epimerase [EC:5.1.3.38]
Organism
bmi  Brucella melitensis ATCC 23457
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMEA_B0845
Enzymes [BR:bmi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.38  D-erythrulose 1-phosphate 3-epimerase
     BMEA_B0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACO02646
UniProt: C0RM13
Structure
PDB: 

Position
II:830951..831883
Genome map
AA seq 310 aa AA seqDB search
MALTLSLNTNPLVNRFAEPDDLIETVARDLRLRDLQLTHEFINPSWQASTIRRLTRDMDR
ALQRTGVRVTSGMTGPYGRLNHFGHPDRDVRRYYVDWFKTFADIIGDLGGKSVGTQFAIF
TYKDFDDPARREELIKIAIDCWAEVAEHAAGAGLDYVFWEPMSIGREFGETIAECMKLQD
RLTAANMAIPMWMMADIDHGDVTSANPDDYDPYAWARTVPKVSPIIHIKQSLMDKGGHRP
FTAAFNAKGRIQPEPLLKAFAEGGAVDNEICLELSFKEREPNDREVIPQIAESVAFWAPH
IDTGAKDLKI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccctgacgctttcgctcaacaccaatccgctggtcaaccgctttgccgagccggac
gacctgatcgaaacggttgcccgcgacctgcgcctgcgtgacctccagcttacccatgag
ttcatcaatccaagctggcaggcctcgaccatccgccgcctcacccgcgacatggacagg
gccttgcagcgcaccggcgtccgcgtcacctccggcatgaccggcccctatggccgcctc
aaccattttggccatcccgaccgggacgtacgccgctattatgtggactggttcaagacc
tttgccgatattatcggcgatcttggcggcaagtccgtcggtacgcagtttgcaatcttc
acctataaggatttcgatgatccggcgcgccgcgaagaacttatcaagatcgccatcgac
tgctgggccgaggtggccgaacatgcggcaggtgcgggcctcgactatgtgttctgggag
ccgatgagcatcgggcgcgaatttggcgagacgattgccgaatgcatgaagcttcaggat
cggctcaccgccgctaacatggcgatccccatgtggatgatggccgatatcgaccatggt
gacgtgacatccgctaacccggacgactacgatccttacgcatgggcccgcaccgtgccg
aaagtctcgcccatcatccatatcaagcaaagcctgatggacaagggcgggcatcgtcct
ttcacagccgcgttcaatgccaagggccgcatccagccggaaccgcttttgaaagccttt
gccgaaggcggcgcggtggataatgaaatctgccttgaactttcgttcaaggagcgcgag
ccgaacgaccgtgaagtcattccacagattgcagaaagtgtggctttctgggcgccgcac
attgacaccggcgctaaggacttgaagatatag

DBGET integrated database retrieval system