KEGG   Brucella melitensis ATCC 23457: BMEA_B0850Help
Entry
BMEA_B0850        CDS       T00867                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
bmi00010  Glycolysis / Gluconeogenesis
bmi00030  Pentose phosphate pathway
bmi00051  Fructose and mannose metabolism
bmi00680  Methane metabolism
bmi01100  Metabolic pathways
bmi01110  Biosynthesis of secondary metabolites
bmi01120  Microbial metabolism in diverse environments
bmi01130  Biosynthesis of antibiotics
bmi01200  Carbon metabolism
bmi01230  Biosynthesis of amino acids
Module
bmi_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:bmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEA_B0850 (fba)
   00030 Pentose phosphate pathway
    BMEA_B0850 (fba)
   00051 Fructose and mannose metabolism
    BMEA_B0850 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    BMEA_B0850 (fba)
Enzymes [BR:bmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BMEA_B0850 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ACO02651
UniProt: C0RM18
Position
II:complement(835030..836094)
Genome map
AA seq 354 aa AA seqDB search
MARITLRQLLDHAAEKGYGVPAFNINNMEQALAIMEAANAVDAPVILQASRGARSYANDI
MLRHMMDAVTEIYPHIPVCVHLDHGNEAATCMSAIQAGFTSVMMDGSLKADGKTPADWDY
NVSVTRQVSEMSHLGGISVEGELGVLGSLETGMGDVEDGHGAEGKLSHDQLLTDPDEAVK
FVRETKVDALAIAMGTSHGAYKFSRKPDGSVLAMHVIEEIHRKLPNTHLVMHGSSSVPEE
LQEIINKYGGQMKPTWGVPVEEIQRGIKHGVRKINIDTDNRMAMTGQIRRILQEEPSEFD
PRKYLKPAMAAMTKLCKERFEQFGTAGHAASIRPIPLSEMAKRYRDGSLDPKFS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcattacgctgcggcaattgctcgatcacgccgctgaaaagggttacggcgtt
ccggcattcaacatcaacaacatggaacaggcactggccatcatggaagcggcaaatgcc
gtggatgcgccggttatcctgcaggcttcgcgcggcgcgcgttcctatgccaatgacatc
atgctccgtcacatgatggatgccgtgacggaaatctatccgcatattccggtctgcgtg
catctcgaccatggcaacgaagccgccacctgcatgagcgccatccaggcgggcttcacc
tccgtcatgatggacgggtcgctgaaggccgacggcaagacgcccgccgactgggactat
aacgtctccgtcacgcgccaggtcagcgagatgtcgcatctgggcggcatttcggtggaa
ggtgagctcggcgttctgggttcgcttgaaaccggcatgggcgatgtcgaagacggccat
ggcgcggaaggcaagctttcgcacgaccagcttctgaccgacccggatgaagctgtgaag
ttcgtgcgcgaaaccaaggtcgatgcgctggcaatcgccatgggcacctcgcacggcgct
tataagttcagccgcaagccggatggttccgtgctcgccatgcatgtgatcgaggaaatc
catcgcaagctgccgaacacccaccttgtcatgcatggttcgtcgtcggtgccggaagaa
ttgcaggaaatcatcaacaagtatggcggccagatgaagccaacctggggtgtgccggtt
gaggaaatccagcgcggcatcaagcatggcgtgcgcaagatcaacatcgatacggataac
cgcatggcgatgaccggccagatccgccgcatcttgcaggaagaaccgagcgaattcgat
ccgcgcaagtacctcaagcccgccatggctgcgatgaccaagctgtgcaaggagcgtttc
gagcagttcggcaccgccggtcacgcggcttccatccgcccgatcccgctttccgaaatg
gcaaagcgttatcgcgacggttcgctggacccgaagttcagctaa

DBGET integrated database retrieval system