KEGG   Babesia microti: BMR1_02g00455Help
Entry
BMR1_02g00455     CDS       T05554                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bmic  Babesia microti
Pathway
bmic00030  Pentose phosphate pathway
bmic00480  Glutathione metabolism
bmic01100  Metabolic pathways
bmic01110  Biosynthesis of secondary metabolites
bmic01130  Biosynthesis of antibiotics
bmic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMR1_02g00455
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMR1_02g00455
Enzymes [BR:bmic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BMR1_02g00455
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BMR1_02g00455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N F420_oxidored UPF0240
Motif
Other DBs
NCBI-GeneID: 24423881
NCBI-ProteinID: XP_012647866
UniProt: A0A1R4A9Z2
Position
II
AA seq 475 aa AA seqDB search
MNMGCDIGIMGLGIMGRGFSLNAARNGYKVSVWTLSESCTDSMFKTSEFASNITIHLDIG
EFVQSLSLPRKILILIPSGKAMDDLLSMLKPKLSYGDIIIDGGNEYYQNAEKRMTDLRSL
GVIYLSMGISGGGEGALNGACLMPSGDKDGYTAIIDIFSKLSAKNNGNPCIAYVGSGSSG
HYVKMIHNGIEYAVMEIISEIYELFKRVGKLNNDQIARKLSDWNQKTIAGSYLLEITSKI
LMCKDTFTDNYLVDSVLDVANSKGTGLICVKESFDLAVPCPTIAAAVSIRNISLLRDLRY
KLFIAFSEISSEYSSIDMNAKNFEEILLSALICSKICAFAQGFMLMDVADKSYGWQIDHS
LITNIWKGGCIIRSKLLDIIAKALKSHQQSLLMDENIVEIMLQNLSRWKEAVRIAHKYNI
SAHAISSSLDYFLSFKCDKMPTNLIQAQRDYFGAHGFQRLDRSGNFHSEWTSETN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgggttgtgatattggtataatgggtttgggtataatgggtagaggattctct
ttgaatgccgcaaggaacggctataaagtctcagtttggacacttagcgagtcatgcact
gattctatgtttaaaacatctgaatttgcctctaacatcacaattcatcttgatataggg
gaatttgttcagtcattatcgctacctcgaaaaatattgattttgataccgtccggtaaa
gctatggatgacctattatctatgttgaaacctaaacttagttacggagatataattatt
gatggaggaaacgagtattatcaaaacgctgaaaaaaggatgacggatttacgttcatta
ggggtcatttatttatcaatgggcataagtggaggaggggaaggcgcattaaacggcgct
tgtctaatgccaagtggcgacaaagatggctatacagccatcatcgatattttttccaaa
ttatctgctaaaaataatggtaacccttgtattgcatatgttggatctggcagtagtgga
cactatgttaaaatgattcataatgggatagaatatgctgtaatggagattataagcgaa
atatatgaactatttaaacgggtgggaaagttgaataatgaccaaatagcaaggaaatta
agcgattggaatcagaaaactattgcagggtcctatctactcgaaattacgtctaagata
cttatgtgcaaagacacttttactgataattatctagtggattcggtgctagatgtagct
aattcaaagggcaccggcttgatttgtgtaaaagaatcgtttgacttggctgttccttgt
cctacaatcgcagccgccgtatccattcgtaacataagtttgcttcgggatcttagatat
aaattgttcatcgcattttccgaaatttcctctgaatattcttcaattgacatgaatgct
aaaaattttgaagagattctattatctgctttaatctgttcaaaaatatgcgcctttgcc
cagggattcatgttgatggacgtagccgataagtcttacggatggcaaatagaccattca
ctgatcaccaacatctggaaaggtggttgcataattcgatctaaactactagatataata
gccaaagcacttaaatcgcatcagcaatcattgctcatggatgagaacattgttgagatt
atgctacaaaatttgagcagatggaaagaggccgtaaggattgcccataagtacaacatt
tctgcccacgcaatctcatcaagtttggattattttctttcattcaaatgtgacaagatg
cctacgaacttgatacaggcgcagagggattattttggggcccacggatttcagagattg
gataggagcggcaattttcactcagaatggacgagtgaaacgaattga

DBGET integrated database retrieval system