KEGG   Babesia microti: BMR1_02g02000Help
Entry
BMR1_02g02000     CDS       T05554                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bmic  Babesia microti
Pathway
bmic00450  Selenocompound metabolism
bmic00970  Aminoacyl-tRNA biosynthesis
bmic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BMR1_02g02000
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMR1_02g02000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmic01007]
    BMR1_02g02000
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmic03016]
    BMR1_02g02000
Enzymes [BR:bmic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BMR1_02g02000
Amino acid related enzymes [BR:bmic01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BMR1_02g02000
Transfer RNA biogenesis [BR:bmic03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BMR1_02g02000
 Prokaryotic type
   Other AARSs
    BMR1_02g02000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 24424184
NCBI-ProteinID: XP_012648167
EnsemblGenomes-Gn: BBM_II02000
EnsemblGenomes-Tr: CCF73558
UniProt: I7I8R7
Position
II
AA seq 708 aa AA seqDB search
MQYTLLLDPSCYHSFACYLASAQFNFPAKIEIAADVNIENRLVSEEYNLSKFKDKKLQIA
TLDTKPVLIVNIGNDLIKIKGIRAILLYIYRYTIKDIDNFYNIYHYFDLLERLEALLTGV
NKLHIDNILQKLDDHLSTSDYLLDKITPVDIYLYSMLSAMHNFHWKNLSKFHSNLHMFAN
HLSKFKLTQQFYDYSTQPYDNLSVDIKKCKNYYIATAIAYTNGLPHLGHVYEMIISDVIA
RYHSIIGKNVLLGVGSDEHGQKIANTASKHGKLPIEICNEYQSKFVECYKSMNVDYSIFT
RTTSDKHKKLCRFMWEKIKNKGDIYLNRYRGWYNEREETFIAPNEAKLNDYKDPQNGMPY
QIMEEESYFFRMSKYQHKLIEYIDSNPHFIQPEIRRNDIIARLSVPLEDLSISRTSFSWG
IKVPDSDNHIMYVWFDALLNYITAVSDNDCNVSDYWPPEMIIIGKDISWFHSVILSTILM
AADLPLPKSIICHGFIHASDGRKMSKSFQNVIDPMELLMAFPCDTIRYYLIKSCILGQDI
KFGTDFLTDAHNNELSDCIGNLVHRVTGLCAKFCDSKVPEINTSVTLQKPFQVMKVLNKI
QDFYAKNDLYNATNFAVDAWRETNKYLTNISPWSISDKCIQNEAIRVLLNSIYILAHLIY
PVIPESSNEIFARLHTPKRMLSKLSPWFDNLASGTKIEVRDVLFTKIT
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatactttattacttgatccttcatgttaccattcattcgcttgttacctagcc
tctgcacaattcaacttcccggcgaaaatagaaattgcagctgatgtcaatatagaaaat
agattagtttcagaagaatataatttatcaaaattcaaagataaaaaattgcaaatagca
acgttagacaccaagccagtattgattgttaacattggtaatgatctgattaagatcaag
ggcattagggcaatactgctatacatatatcgctacactattaaggatattgataatttt
tacaacatataccactattttgatctgctggaaaggttggaggctttgcttaccggtgta
aacaaattgcacattgataatatcctccagaaattggatgatcatttatcaacttccgat
tatctattagataaaattacacccgttgatatatatctttactcaatgttatcagcaatg
cacaattttcattggaaaaatttatcaaaatttcattcaaacctacacatgtttgcaaat
cacttatcaaagtttaaattgacgcaacaattttacgattattccacacaaccctatgat
aatctttcagtggacattaagaaatgtaaaaactattacattgcaaccgccatcgcctac
acaaatggactacctcacctgggtcatgtatatgaaatgattatatccgatgttattgca
agataccattcgattataggcaaaaatgttttattaggtgtaggatctgatgagcatggg
cagaaaattgcaaacaccgcttcaaaacatggaaaattacccattgaaatttgcaatgaa
tatcaaagtaaatttgtcgagtgttacaaaagtatgaatgtagattatagtattttcacc
cgaacaaccagtgataaacacaaaaaattgtgccgttttatgtgggagaaaattaagaat
aagggggatatatatttgaataggtataggggttggtacaatgaaagggaggagacattt
atagccccaaatgaagcaaaattaaatgattataaggatccacagaacggaatgccatat
caaattatggaggaggaatcatatttcttcagaatgtcaaaatatcaacataaattaata
gagtacattgattcaaaccctcactttatccagcccgaaattagaagaaatgatattatt
gccaggcttagtgtacctttggaagatttgtccatcagcagaaccagtttttcttgggga
ataaaagtccccgactctgataatcacataatgtacgtctggttcgatgctttactcaat
tacataactgcggtatccgataatgattgtaacgttagtgattattggcctcctgaaatg
ataataattggcaaagacatttcctggttccattcggtaatcctatctactatcttaatg
gcggctgatttgcccctaccaaaatctattatatgccatggattcatccatgcttctgat
ggaagaaaaatgtctaaaagtttccaaaacgttatcgacccaatggagcttctaatggcc
tttccatgtgatacaattagatattatttaataaaatcttgcatattagggcaagatatc
aagtttggcacggactttcttacagatgcacataataatgaattgtccgattgcattggg
aatttggtgcacagagtcactggattatgtgcaaaattttgtgattccaaagtgccagaa
ataaacacgagtgtgactttgcaaaagccattccaggttatgaaggttttgaataaaatt
caagatttttatgccaaaaacgatctatataatgctacaaattttgcagtagatgcatgg
cgagaaactaataaatatttgactaatatttccccatggtctatcagcgataaatgcata
caaaatgaagcgatccgtgttctacttaattccatatacattctggctcatttgatctat
ccggtaatccctgaatcttcaaatgaaatatttgccagattacataccccaaaacgtatg
ttgtctaaattatctccttggtttgacaatttggcatccggaaccaaaattgaagttagg
gacgtgttatttacgaaaattacctaa

DBGET integrated database retrieval system