KEGG   Babesia microti: BMR1_02g04040Help
Entry
BMR1_02g04040     CDS       T05554                                 

Definition
(RefSeq) ATP-dependent RNA helicase dhx8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bmic  Babesia microti
Pathway
bmic03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bmic00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    BMR1_02g04040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bmic03041]
    BMR1_02g04040
Enzymes [BR:bmic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BMR1_02g04040
Spliceosome [BR:bmic03041]
 Complex C
  Other components
   Step II factors
    BMR1_02g04040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 Helicase_C OB_NTP_bind DEAD AAA_19 AAA_29 AAA_30 DUF87 AAA_22
Motif
Other DBs
NCBI-GeneID: 24424588
NCBI-ProteinID: XP_012648565
EnsemblGenomes-Gn: BBM_II04040
EnsemblGenomes-Tr: CCF73956
UniProt: I7IGJ2
Position
II
AA seq 650 aa AA seqDB search
MEELLISIVQDEIVHKLKLSNTLLIIASTGSGKSTLLPGILVSNGYTDNGIVGISQPRRV
AAISLAKRVSSLLNCKIGGFVGVSVRFHNNTTAQTRVLFATDGILVREALIDPIFSRFSV
IIVDEAHERSLRSDVLFGLLVIAQRRRPELKVVIMSATLEYENFVKFFKDVQLVKVEGRQ
HPIEIHHIRSECEDYLEAAVFATLMINSRSEPGDILVFLPGQEEIESFCGILNSKLKKIE
QEAKGKTPKSVLLRIGKRTCNYSQWMQMVILPLYAALPLAQQELVFVKAHNMRKVIAATN
IAETSLTIPGVRFVVDSGLEKQKSFSAKRGIEVLALKIISKASARQRAGRAGRESKGFVY
RIYTKDSFDKMPEFTTPEILRTNVTQPFLELAAMGIKGISEFPMIDSPSQESFLVAIATL
CRLGALDRAGSITEMGKLIVKIPTSPIYAKLLIISRHLNCFDEILTMVSMLSVDVPWITN
FSGSSNKGFKNAKMRISNTSSDHLTLINLYNLYKKSKNPESFCAAFGIKHNVMKYAEQIR
IQLESIVDTLSIDATKINMKLQPPEFEDPNDYVLWTLAQGSWIKTAILDPDKLHYRTILE
KQKVKIHLSSVINRTKLPNYIVYDECVSTSTTYVRIVSSLDKFDIRKPEK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggaagagttgttaataagcatagtgcaagatgaaattgtgcataagttaaaactcagc
aatacgctgctaattatagcctccacaggtagtggaaaatcaacacttttgcccggaatt
ctggtgtcaaatggatacactgataatggcatcgtcggtatatcacaaccgagacgagtt
gcagcaatttctctggccaaaagagtgtcttcgctcctaaattgtaaaattggcggattt
gtaggggtttcagtgagattccacaacaacacaacagcacaaaccagagtgctgtttgcc
actgatggaattttggtacgtgaagcactaattgatcccatttttagtaggtttagtgtg
ataattgttgatgaagctcacgaaagatcgctaaggagtgatgtcttatttgggctacta
gtcattgcacagcgtaggagacctgagctaaaggtcgttattatgtctgcaacattggag
tatgaaaattttgtcaagttttttaaggatgttcaacttgtcaaggtggagggtaggcag
catcccattgaaattcaccatataagatcggaatgcgaggattacttagaggctgcggta
tttgctactctaatgataaattctagatccgaacctggtgatattttagtatttttaccg
ggacaagaagaaatagagtctttttgtggcattttaaattctaagctcaagaaaattgag
caggaagccaagggtaaaacgcctaaatctgttctactgagaattggtaaaaggacttgt
aattactcgcaatggatgcaaatggttattttgcccttgtacgcagcactacctctggcc
cagcaggaacttgtgtttgtaaaggctcataatatgagaaaggtaattgctgccaccaac
atcgctgaaacatcactcacaattccaggtgttagatttgttgtggactctggtcttgag
aaacaaaaatctttctcggcgaagagaggtattgaagttctagcccttaaaatcatatca
aaggcttcagctagacaacgagcaggtcgagctggtagggagtctaaaggatttgtctat
cgaatttatactaaggactcctttgacaagatgcctgaatttaccacgcctgaaatctta
cgcactaatgttactcagcccttcttagagctagccgctatgggcataaaaggcatttca
gagttccctatgatagattctcccagtcaagaatcctttttggttgcaattgccacgctg
tgtaggctaggtgcattggatagagctggcagtattactgaaatgggtaaactgattgtc
aaaatacccaccagtccaatttatgccaaattgcttataatttcaagacatttaaattgt
tttgatgagatcctaactatggtatcaatgctttcagtagatgtgccctggataaccaat
ttttctggcagtagtaataaaggttttaagaatgccaaaatgcgcatttcaaacacaagt
agtgaccatttgaccctcataaatctatataatctgtacaaaaagtccaaaaacccagaa
agcttctgtgccgcttttggtataaaacacaatgtaatgaagtatgcagagcaaattaga
atccaattagagtcaattgttgatactctaagcatcgatgccacaaaaattaatatgaaa
cttcagccaccagaatttgaagacccgaatgactatgtactatggacactcgctcaagga
agttggattaaaacggcaatacttgaccctgataagttgcactacaggaccattctggag
aaacaaaaggtaaagattcatctatcctcagtgattaaccgtacaaaactgccaaattat
attgtgtacgatgaatgtgtgtcaaccagtactacttacgtgagaattgtcagttccctg
gataaatttgacattagaaagccagaaaagtga

DBGET integrated database retrieval system