KEGG   Babesia microti: BmR1_04g09695Help
Entry
BmR1_04g09695     CDS       T05554                                 

Definition
(RefSeq) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bmic  Babesia microti
Pathway
bmic00020  Citrate cycle (TCA cycle)
bmic00620  Pyruvate metabolism
bmic01100  Metabolic pathways
bmic01110  Biosynthesis of secondary metabolites
bmic01130  Biosynthesis of antibiotics
bmic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BmR1_04g09695
   00620 Pyruvate metabolism
    BmR1_04g09695
Enzymes [BR:bmic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BmR1_04g09695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mqo DAO NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 24426561
NCBI-ProteinID: XP_021337963
Position
IV
AA seq 481 aa AA seqDB search
MIPLKFVKSVAKPKNSATSPHLTSRNFSTTNVDVFIVGGGVSGTALFYTLSKFTNVRRIV
LCERRSDYGLVASHAKNNSQTIHCGDIETNYTPETAIKVKRCADMLRNYLTKLPPSEAQR
ICQIGQKMVLGVGDRECQFLSDRYKPFKEIFPTLEYLDKEQIRNVEPNVVKGRWRSERPE
QLNALYVANEHTTAEYGLLSRSFIKSSMSLNDPYKSIQPLLNTTLKRVKPLDDGTYHVIT
SAGNFNAKFVVFSACGYSLYFAHQLGYGLEYSVLPVAGSFYFAPNVLKGKVYTVQNPVLP
FSAIHGDPDILLSDKCRFGPTAVPLPFLERYNYWSLFAFLRVLKIDRNVMCVYKDLFTKP
EILRYMIKNFFFEIPIISRILFLKDARKIVPSLSFRDLEYSKGFGGVRPQLIDKNQRKLL
FGQTKISANTGLIFNVTASPGATTCLSNAEIDMRQICEYLDAKLDEASFKKELLQGDYPI
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctaaaatttgtgaaatctgtggctaaacccaagaattcagcaacttctccg
catttgactagtaggaattttagtacaacaaatgtggacgtctttatagtaggcggtgga
gtgtctggtaccgcgctattctacacactatctaagtttacaaatgtgagaaggattgtg
ctttgtgaaagacgatcggattatggattggttgcttcccatgccaaaaacaatagccaa
accatccattgtggggacattgaaaccaattacactccagaaacagcgattaaggtcaaa
aggtgcgctgatatgctgagaaattatttaaccaagctaccaccatcagaagctcaacga
atttgtcaaataggtcagaagatggttttgggggtgggagatagggagtgtcaattcctt
agtgatagatataagccttttaaggagatatttcccacgcttgagtacttggataaggaa
caaatcagaaatgtcgaaccgaatgttgttaagggtcgatggaggtcagaacggccagaa
cagcttaacgccttatatgtagctaacgaacatacaactgctgaatatgggctacttagc
agatcatttatcaaatcttccatgtcactaaatgatccatataaatccattcagcccctc
ctcaatactacactcaaaagggtgaagccccttgacgatggtacttatcatgtcataact
tctgctggtaatttcaatgccaaatttgtcgtgttcagtgcatgtggatactcgctttat
tttgcacatcaattgggctatggattggagtatagcgtattgcctgtggctggcagcttt
tattttgccccaaatgttctaaagggtaaagtttacactgtgcaaaatccagtgctcccg
tttagtgcgattcatggagatccagatatcttactatccgataagtgccggtttggacca
actgcagtacccttgccatttttagaaaggtacaactattggagcctctttgcattccta
agggtactaaagatagatcgcaatgtgatgtgtgtttataaggatttgttcactaagccc
gaaattctgagatatatgattaagaacttcttttttgagattcccatcatttctcgtatt
cttttcttgaaggatgcaaggaagatagtacctagtctaagcttcagggacctggaatat
tccaaggggtttgggggtgttaggccacagctgatagacaagaatcagaggaaacttttg
tttggtcagacaaaaatatcagccaatacggggctaatattcaatgtaactgcatcacct
ggtgccacaacttgtttgtcaaacgctgaaattgacatgagacagatctgtgagtatttg
gatgcgaaactggacgaggcatcttttaagaaggaattgttgcagggggattatcctatt
ttataa

DBGET integrated database retrieval system