KEGG   Borrelia miyamotoi CT14D4: RJ61_02555Help
Entry
RJ61_02555        CDS       T03577                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bmiy  Borrelia miyamotoi CT14D4
Pathway
bmiy00480  Glutathione metabolism
bmiy00590  Arachidonic acid metabolism
bmiy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmiy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RJ61_02555
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RJ61_02555
Enzymes [BR:bmiy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RJ61_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AJA58663
UniProt: A0A1D8TE91
Position
533826..534308
Genome map
AA seq 160 aa AA seqDB search
MSVYGFRVRLASGPEISLSDYMHKVLLIVNVASNCGYTNQYYDLEMLYKLYKRRGFFILG
FPCNQFGFQEPGSDSEILKFCHTVYNVSFPILSKIDVDGENAHPLYKYLIEHSPWNIRGR
IRWNFTKFLIDRKGRVVDRYESKISPVDFRDKIEKLLKMI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtatggttttagagtaaggcttgcgtcagggcctgagatttctctttcggat
tacatgcataaggtattgcttatagttaatgtggcaagtaattgtggttatacaaatcaa
tattatgatttggaaatgctttataagctatataagaggagaggatttttcatattggga
tttccttgtaatcagtttggatttcaggagcctgggtcagatagtgagattttaaaattt
tgtcatacggtttataatgtttcgtttcctattttgtctaaaattgatgttgatggagaa
aatgcacatcctctatataaatatcttatagaacattctccatggaacataaggggaagg
attcgttggaattttactaaatttttaatagatagaaaaggcagagtggtagatcgatat
gagtctaagatatctccagttgattttagagataaaattgaaaaattattaaagatgatt
taa

DBGET integrated database retrieval system