KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00304
Entry
BMULJ_00304       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_00304
Secretion system [BR:bmj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMULJ_00304
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: BAG42279
UniProt: A0A0H3KBG8
Position
1:318229..318744
AA seq 171 aa
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDR
KFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFNPDEVVEQVEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQALAKGTGGDKDGE
NT seq 516 nt   +upstreamnt  +downstreamnt
atggccaagaaagagagcattcagaaaagcttgcagaaaatacggccgccgcgcgtccag
ctgacctacgaggtcgagaagggcgatgcgatcgaggtgaaggagctgccgttcgtcgtc
ggggtcgtcgcggatctggccggccagtccgaagtcgagcagccgaagcttcgcgatcgc
aaattcgtcaacatcgatcgcgacaatttcgacgacgtgatgaaggcgatcgagccgcgc
gcggcgttccaggtggaaaaccggctgagccccgagggcggcaagttcgcggtcgacctg
aaattccgttcgctgtcggatttcaatccggacgaagtcgtcgagcaggtcgagccgctg
cgccgcctgctcgaggcgcgctcgaagctcgccgacctgcgcaacaagctcgccggcaac
gacaagctcgaggacctgctgtccgaggtgctgaagaacacgcagcagctgcaggcgctc
gcgaagggcacgggcggcgacaaagacggcgaatga

DBGET integrated database retrieval system