KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00305
Entry
BMULJ_00305       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_00305
Secretion system [BR:bmj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMULJ_00305
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: BAG42280
UniProt: A0A0H3KGE8
Position
1:318760..320250
AA seq 496 aa
MNQQTAPAQASGAEYAAGTSLLDEIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVVVS
DNLSATIDARVAELDRLISAQLSAVMHAPEFQRLESTWRGLDYLVKESNTGQTIKIKALH
APKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQM
SHVAAAAHAPFIASASPELLGLESFADLGKPRDLGKVFDTVEYAKWKSFRDSEDSRYVGL
TLPRFLGRLPFNPKDGQTAETFNFVEDVDGTDHDKYLWCNAAWAFAARLTAAFDDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaaccagcaaacggctccggcccaagcgagcggcgcggaatacgccgccgggacttcg
ctgctcgacgaaatcgtcgagaagagcaaggtcgcgaaatccgattccgagcatgcgcgc
gcgaaggacctgatcggcgaactcgtgcaccaggtgctcgacggcacggtggtcgtgtcg
gacaacctgtcggcgacgatcgacgcgcgcgtcgcggagctcgatcggctgatctcggcg
caactgtccgcggtgatgcacgcgccggaattccagcgcctcgaaagcacgtggcgcggg
ctcgactatctggtcaaggaaagcaacacgggccagacgatcaagatcaaggcgctgcac
gcaccgaagcgcgacctcgtgcgcgacttcaagggcgccagcgagttcgaccagagcgcg
ctgttcaagaaggtctacgaagaagagttcggcacgttcggcggctcgccgttcggcgcg
ctgatcggcgactacgagatctcgcgtcagccggaagacatgtacttcatcgagcagatg
tcgcacgtcgcggcggccgcgcacgcgccgttcatcgcgtcggcgtcgccggagctgctc
ggcctcgaatcgttcgccgatctcggcaagccgcgcgatctcggcaaggtgttcgacacg
gtcgaatacgcgaagtggaagtcgttccgcgattccgaggattcgcgctacgtcggcctc
acgctgccgcgcttcctcggccgcctgccgttcaatccgaaggacggccagaccgcggaa
accttcaacttcgtcgaagacgtcgacggcaccgaccacgacaagtatctgtggtgcaac
gccgcgtgggcattcgccgcgcggctgacggccgcattcgacgacttcggctggtgcgcg
gcgattcgcggcgtcgagggcggcgggctcgtcgaggatctgccgacgcacaccttcaag
accgacgacggcgaagtcgcgctgaagtgcccgaccgagatcgcgatcaccgatcgccgc
gagaaggagctgagcgatctcggcttcatcccgctcgtccattgcaagaattctgattac
gccgcgttcttcgctgcgcaatcggtgcagaaaccgaaaaaatacagcaccgacagcgcg
aacgcgaacgccgtactctctgcccagcttcagtacatcttctcggtatcgcgcgttgcg
cattacctgaaggcgatgatgcgggacaagatcggcagcttcgcgtcggcgcagaacgtg
gagaccttcctcaaccggtggatttcgcaatacgtgctgctcgacgacaacgcgacgcag
gagcagaaggcgcaatttccgctgcgcgaggcatccatacaagtatcggagattccgggc
aagccgggctcgtatcgttcggtcgcattcctgcgcccgcactttcagctcgacgaactc
tcgatttctctgcgacttgtcgctgatctgcccaaaccggcaaattcataa

DBGET integrated database retrieval system