KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00306Help
Entry
BMULJ_00306       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMULJ_00306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_00306
Secretion system [BR:bmj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMULJ_00306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: BAG42281
UniProt: A0A0H3KBS7
Position
1:320322..320825
Genome map
AA seq 167 aa AA seqDB search
MLHMHMQFGSPAIKGESADKDHQGWIELKSWDHSIIQPRSATASTAGGHTATRCEHGDMI
FTKEIDSSSPLLYQHASGGTTFDEVTIHFSRADGEGKRVQYLEIKLKYVIISSIAPSVRE
EGLPVETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgttacacatgcacatgcagtttggtagtccggcgatcaaaggcgaatccgcggacaag
gaccaccagggctggatcgaactgaaatcgtgggatcactcgatcatccagccgcgttcg
gcgaccgcgtcgaccgcaggcggccacaccgccacgcgttgcgagcacggcgacatgatc
ttcacgaaggaaatcgattcgtcgagcccgctgctgtatcagcacgcgtcgggcggcacg
acgttcgacgaagtgacgattcatttctcgcgtgcggacggcgaaggcaagcgtgtccag
tatctggaaatcaagctcaagtacgtgatcatctcgagcatcgcgccgagcgtgcgcgag
gaaggcctgccggtcgagacgttctcgctgaagtatgcggccgtgcagtggaagcagacg
cagcagaagatcggcggcaaccagggcggcaacacgcagggcgcctggagcctgacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system