KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00310Help
Entry
BMULJ_00310       CDS       T00740                                 

Gene name
clpB
Definition
(GenBank) protease associated ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMULJ_00310 (clpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_00310 (clpB)
Secretion system [BR:bmj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMULJ_00310 (clpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small Clp_N AAA_16 AAA_22 Sigma54_activat AAA_7 TniB AAA_30 ResIII NACHT SRP54 Zeta_toxin AAA_23
Motif
Other DBs
NCBI-ProteinID: BAG42285
UniProt: A0A0H3KGF1
Position
1:324396..327065
Genome map
AA seq 889 aa AA seqDB search
MSTPLKTLITKLNPLCRHAAERAASACLARGHYEVDLEHLFLALLEEPAGDLSLALRASR
IDAHALRADLERELTRLKTGNTRTPVFSVHLIALFEQAWLIASLDSQLGRIRSGHLLLAL
LTAPDLAQFAQRMSARFSEVNVTDLKHKFDEITAGSSEAEPHRADAEHGDAAAPAEGGAP
AAGASKTPALDTYTTNLTQRARDGKIDPVIGREAEIRQAIDILMRRRQNNPIMTGEAGVG
KTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASVKGEFENRLKSVIDEVKKSPH
PIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALAR
RFQVVKVEEPSESLAAAMLRGMAGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSATPAAIDDTKKRTERIDAEIASLERDAASGAAHDERLGELRGARD
AALEQLAKDEARYEAERAIVAEITALRETLDRARAPADDGQPVDVQATREKLAERVAALH
ALQGGEPMVPLQVDGHVVAEIVAAWTGIPLGRMVKDEIGTVLNLKPLLAARVIGQDHALE
AIAQRVRTASANLEDPNKPRGVFMFVGPSGVGKTETALALADILYGGERKMITINMSEYQ
EAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGM
MDDAEGREIDFRNTLIILTSNVGSAAVMQACLNKPAEELPDPDALAEALRPQLYKAFKPA
FLGRMKVVPYYPISDDVLAEIIELKLERIRSRIEANHKAAFEWDESLVEAVLARCTEVDS
GARNVDHILNGTLLPEIAGHVLGRIADGASIARIAVRADDAGEFAYTVE
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcctctgaagaccctcatcacgaaactgaatccgctgtgccggcatgcggcc
gagcgtgcggcgagcgcgtgtctcgcgcgcggccattacgaggtcgatctggagcatctg
tttctcgcgctgctcgaggagccggcgggcgacctgtcgctcgcactgcgcgcaagccgc
atcgacgcgcatgcgttgcgcgccgatctcgagcgcgagctcacgcgcctgaagaccggc
aacacgcgcacgcccgtattctccgtgcatctgatcgcgctgttcgagcaggcgtggctg
atcgcgtcgctcgactcgcagctcggccgcatccgctcgggccacctgctgctcgcgctg
ctcacggcgccggacctcgcgcagttcgcgcagcggatgtcggcgcgcttttccgaagtg
aacgtgaccgatctgaagcacaagttcgacgagatcacggccgggtccagcgaagccgag
ccgcatcgtgcggacgcggagcacggcgacgccgctgcgccggccgagggcggcgcgccg
gcagcgggcgcatcgaagacgcccgcgctcgacacgtacacgacgaacctcacacagcgt
gcacgcgacgggaagatcgacccggtgatcggccgcgaagccgagatccgtcaggcgatc
gacatcctgatgcggcgccgccagaacaatccgatcatgacgggcgaggccggcgtcggc
aaaacggccgtcgtcgaagggctcgcgctgcgcatcgcagccgacgacgtgccgccgccg
ctgcgcggcgtcgcgctgcacgtgctcgacatggggctgctgcaggccggcgcgagcgtg
aagggcgagttcgagaaccgtctgaagagcgtgatcgacgaggtcaagaagagcccgcat
ccgatcatcctgttcatcgacgaggcgcacacgatcatcggcgcgggcggacaggccggc
cagaacgacgcggcgaacctgctgaagcccgcgcttgcgcgcggcgagctgcgcacgatc
gcggcgacgacgtggagcgaatacaagaagtacttcgagaaggatgccgcgctcgcgcga
cgcttccaggtggtgaaggtcgaggaaccgagcgagtcgctggcggccgcgatgctgcgc
ggcatggccggactgatggagaagcacttcaacgtgcggattctcgacgacgcgatcacc
gaggccgtccggctctcgcatcgctatatcagcgggcggcaactgccggacaaggcgatc
agcgtgctcgacaccgcgtgcgcgaaggtcgcgctcgcgcacagcgcgacgccggccgcg
atcgacgacacgaaaaagcgcaccgagcgcatcgacgcggaaatcgcgtcgctcgagcgt
gatgcggcaagcggcgcggcgcacgacgaacgactcggcgagctgcgcggcgcgcgcgac
gcggcgctcgaacagctcgcgaaggacgaagcgcgctacgaggcggaacgtgcgatcgtc
gccgagatcaccgcgctgcgcgagacgctcgatcgcgcccgcgcgccggccgacgacggc
cagccggtcgacgtgcaggccacgcgcgagaagctcgccgaacgcgtcgcggcgctgcat
gcactgcagggcggcgagccgatggtgccgctgcaggtcgacggtcacgtggtggccgag
atcgtcgctgcgtggaccggcattccgctcggccggatggtgaaggacgagatcggcacc
gtgctcaatctgaagccgctgctcgccgcgcgcgtgatcggccaggaccatgcgctcgaa
gcgatcgcgcaacgcgtgcgcaccgcgtcggcgaacctcgaggatccgaacaagccgcgt
ggcgtgttcatgttcgtcgggccgtcgggcgtcggtaagaccgagacggcgctggcgctc
gcggacatcctctacggcggcgagcgcaagatgatcacgatcaacatgagcgagtatcag
gaggcgcacagcgtgtccggcctgaagggttcgccgccgggctacgtcggttacggcgaa
ggcggcgtgctgaccgaggctgtgcggcgcaatccgtattcggtcgtgctgctcgacgag
gtcgagaaagcgcatccggacgtgctcgagatgttcttccaggtgttcgacaagggcatg
atggacgacgccgaagggcgcgagatcgacttccgcaacacgctgatcatcctgacgtcg
aacgtcggttcggccgcggtgatgcaggcgtgcctgaacaagccggccgaggaactgccc
gatcccgatgcgctcgcggaagcgctgcgcccgcagctgtacaaggcgttcaagcccgct
ttcctcggccggatgaaggtggtgccgtactacccgatctccgacgacgtgctcgccgag
atcatcgagctgaagctcgaacggattcgcagccgcatcgaggcgaaccacaaggccgcg
ttcgaatgggacgaatcgctcgtcgaagcggtcctcgcgcgctgtaccgaagtcgactcg
ggcgcacgcaacgtcgaccacatcctgaacggcacgctgctgccggagatcgcgggccac
gtgctgggccggatcgccgacggcgcgtcgattgcgcgcatcgcggtgcgcgcggacgac
gccggcgagttcgcatacacggtcgaatga

DBGET integrated database retrieval system