KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00545Help
Entry
BMULJ_00545       CDS       T00740                                 

Gene name
purH
Definition
(GenBank) phosphoribosylaminoimidazolecarboxamide formyltransferase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00230  Purine metabolism
bmj00670  One carbon pool by folate
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMULJ_00545 (purH)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BMULJ_00545 (purH)
Enzymes [BR:bmj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     BMULJ_00545 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     BMULJ_00545 (purH)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMULJ_00545 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-ProteinID: BAG42509
UniProt: A9AH70
Position
1:complement(582432..583997)
Genome map
AA seq 521 aa AA seqDB search
MIKQALISVSDKTGIVDFAKSLSDLGVKLLSTGGTAKLLADAGLPVTEVADYTGFPEMLD
GRVKTLHPKVHGGILARRDLPEHMQALEAHDIPTIDLLVVNLYPFVATIAKDDCTLADAI
ENIDIGGPTMLRSAAKNHRDVTVIVDPADYAVVLDEMKANGNTVGYATNFRLATKVFAHT
AQYDGAITNYLTSLTDELKHGSRNPYPATLNMAFEKVQDLRYGENPHQSAAFYRDIVTPA
GALANYRQLQGKELSYNNIADSDAAWECVKTFDAPACVIIKHANPCGVAVGNDSADAYAK
AFQTDPTSAFGGIIAFNREVDEAAAQAVAKQFVEVLIAPSFTDAAKQVFAAKQNVRLLEI
ALGEGHNAFDLKRVGGGLLVQSLDAKNVQPHELRVVTKRHPTPKEMDDLLFAWRVAKYVK
SNAIVFCGNGMTLGVGAGQMSRVDSARIASIKAQNAGLTLAGSAVASDAFFPFRDGLDVV
VAAGATCVIQPGGSVRDDEVIAAADEHNIAMILTGVRHFRH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagcaagcgctcatttccgtttccgacaagaccggcatcgtcgacttcgcgaag
tcgctgtccgacctcggcgtcaagctgctgtcgacgggcggcaccgcgaaactgctcgcc
gacgcgggcctgcccgtcaccgaagtggcggactacacgggctttccggaaatgctcgat
gggcgcgtgaagacgctgcatccgaaggtgcacggcggcatcctcgcgcgtcgcgatctg
cccgagcacatgcaggcactggaagcgcacgacatcccgacgatcgacctgctcgtcgtg
aacctttatccgttcgtcgcgacgatcgcgaaggacgattgcacgctcgccgacgcgatc
gagaacatcgacatcggcggcccgacgatgctgcgctcggccgcgaagaaccaccgcgac
gtgacggtgatcgtcgatccggccgactacgcggtcgtgctcgacgaaatgaaggcgaac
ggcaacacggtcggctacgcgacgaacttccggctcgcgacgaaggtgttcgcgcacacc
gcgcaatacgacggcgcgatcacgaactacctgacgagcctcaccgacgaactgaagcac
ggctcgcgcaatccgtacccggcgacgctgaacatggcgttcgagaaggtgcaggacctg
cgctacggcgagaacccgcaccagagcgcggcgttctatcgcgacatcgtcacgccggcc
ggcgcgctcgcgaactaccgccagctgcagggcaaggaactgtcgtacaacaacatcgcc
gattcggacgcggcgtgggaatgcgtgaagacgttcgacgcgccggcctgcgtgatcatc
aagcatgcgaacccgtgcggcgtcgcggtcggcaacgactcggccgatgcgtacgcgaag
gcgttccagaccgacccgacgtcggcgttcggcggcatcatcgcgttcaaccgcgaagtc
gacgaagccgcggcgcaggccgtcgccaagcagttcgtcgaagtgctgatcgcgccgtcg
ttcaccgatgccgcgaagcaggtgttcgccgcgaagcagaacgtgcgtctgctcgagatt
gcgctgggcgaaggccataacgcgttcgacctgaagcgtgtcggcggcggcctgctcgtg
cagtcgctcgatgcaaagaacgtgcagccgcacgagctgcgcgtcgtcacgaagcgtcat
ccgacgccgaaggagatggacgacctgctgttcgcgtggcgcgtcgcgaagtacgtgaag
tcgaacgcgatcgtgttctgcggcaacggcatgacgctcggcgtcggtgccggccagatg
agccgcgtcgactccgcgcgcatcgcaagcatcaaggcgcagaacgcgggcctgacgctg
gccggttcggccgtcgcgtcggatgcgttcttcccgttccgcgacggtctggacgtggtc
gtcgcggcaggcgcgacctgcgtgatccagccgggcggctcggtgcgcgacgacgaagtg
atcgcggcagccgacgagcacaatatcgcgatgatcctgacgggcgtgcgtcacttccgt
cactga

DBGET integrated database retrieval system