KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00614Help
Entry
BMULJ_00614       CDS       T00740                                 

Gene name
purM
Definition
(GenBank) phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00230  Purine metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMULJ_00614 (purM)
Enzymes [BR:bmj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     BMULJ_00614 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: BAG42578
UniProt: A9AGA9
Position
1:664323..665378
Genome map
AA seq 351 aa AA seqDB search
MNPPKSAPDAQGLSYRDAGVDIDAGDALVDKIKPFAKKTLRDGVLGGIGGFGALFEVPKK
YKEPVLVSGTDGVGTKLKLAFHLNKHDTVGQDLVAMSVNDILVQGAEPLFFLDYFACGKL
DVDTAATVVKGIAQGCELSGCALIGGETAEMPGMYPDGEYDLAGFAVGAVEKSKIIDGST
IAEGDVVLGLASSGIHSNGFSLVRKIIERANPDLSADFHGRSLADALMAPTRIYVKPLLA
LMQKIAVKGMAHITGGGLVENIPRVLREGLTAELDQKAWPLPPLFKWLQEHGGVADAEMH
RVFNCGIGMAVIVSAADADAAVSDLTAAGEQVWKIGTVRASREGEAQTVVV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctccgaaatccgctcccgacgctcagggtctgtcctaccgcgacgcaggcgtc
gacatcgatgccggcgacgccctcgtcgacaagatcaagccttttgcgaagaaaaccctg
cgcgatggcgtgctcggcggcatcggcgggttcggtgcgctgttcgaagtgccgaagaag
tacaaggagcccgtgctcgtgtccggcaccgacggcgtcggcaccaagctcaagctcgcg
tttcatctgaacaaacacgacacggtcggccaggatctcgtcgcgatgagcgtgaacgac
atcctcgtgcaaggcgccgagccgctgttcttcctcgactacttcgcgtgcggcaagctc
gacgtcgatacggccgccacggtcgtcaagggcatcgcgcaaggctgcgaactgtcgggc
tgcgcgctgatcggcggcgaaacggccgaaatgccgggcatgtatccggacggtgaatac
gatctggccggcttcgcggtcggcgcggtcgagaagagcaagatcatcgacggcagcacg
atcgccgaaggcgacgtcgtgctcggcctcgcatcgagcggcatccactcgaacggcttc
tcgctcgtgcgcaagatcatcgagcgcgcgaatcccgatctgtcggccgatttccacggc
cgctcgctcgccgacgcgctgatggcgccgacgcgcatctacgtgaagccgctgctcgcg
ctgatgcagaagatcgccgtgaagggcatggcgcacatcacgggcggcggcctcgtcgag
aacattccgcgcgtgctgcgcgaaggcctgacggccgagctcgaccagaaggcgtggccg
ctgccgccgctgttcaagtggctgcaggagcacggcggcgtcgccgatgccgaaatgcac
cgcgtgttcaactgcgggatcgggatggccgtgatcgtgtcggcggcggatgccgacgca
gcggtctccgatctgacggctgccggcgaacaggtgtggaagatcggcaccgtgcgcgcg
agccgcgaaggcgaggcgcagacggtcgtggtctga

DBGET integrated database retrieval system