KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00802Help
Entry
BMULJ_00802       CDS       T00740                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00030  Pentose phosphate pathway
bmj00480  Glutathione metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Module
bmj_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMULJ_00802 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMULJ_00802 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmj04147]
    BMULJ_00802 (zwf)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BMULJ_00802 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BMULJ_00802 (zwf)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BMULJ_00802 (zwf)
  Exosomal proteins of colorectal cancer cells
   BMULJ_00802 (zwf)
  Exosomal proteins of bladder cancer cells
   BMULJ_00802 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAG42762
UniProt: A0A0H3KCQ6
Position
1:complement(878021..879490)
Genome map
AA seq 489 aa AA seqDB search
MHTDSSFTFVLFGGTGDLSMRKILPALFEAHRANMLAQSGRIVAVARHESDRAGYLEWVD
THVKPHAAKAAGSAFDQAAWQSFLERIEYVKLDLGRAEDYAVLRDAVEPLPGIRVFYLAT
GPSLFVPICKALASVGLNEGSRIVLEKPLGYDLRSSNAINDAVGEIFAEDQIYRIDHYLG
KEPVQNLLALRFGNALFEPLWRREWVESIQITIAEELGVEARGDFYDNTGALRDMVQNHL
LQLLSIVAMEPPHSMDSDSVRDEKLRVLRALKPVDPRDIGKVAVRGQYHAGVIKGVQVPA
YATEPGVKPDSQTETFVALKAEIENWRWAGVPFFLRTGKRLADRVAEIVVNFRPVPHSAL
GPTALRPGANRLVIRLQPNETIRLYCLAKQPGEGMNLASVHLDLAFDQFFKEGQMEAYQR
LLLDVINGRLALFVRRDEQEAAWRWVEPILNEWARSLKPPKPYAAGTWGPAASSAMLAQH
GTCWLEEEN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgattccagctttaccttcgtacttttcggcggcaccggcgatctgtcgatg
cgcaagatcctgcctgcgctgttcgaagcgcaccgcgcgaacatgctcgcgcaaagcggc
cggatcgttgccgtcgcgcggcacgaatcggatcgggccgggtatctcgaatgggtcgac
acgcacgtgaagccgcatgcggcaaaggcggcgggcagcgcgttcgatcaggccgcgtgg
cagtccttcctcgagcgcatcgaatacgtgaagctcgatctcggccgcgcggaagactat
gcggtgctgcgcgatgcggtcgagccgctgcccggcatccgcgtgttctatctcgcgacg
gggccgtcgctgttcgtgccgatctgcaaggcgctcgcatcggtcgggctcaacgaaggc
tcgcgcatcgtgctcgagaagccgctcggctacgacctgcgctcgtcgaacgcgatcaac
gacgcggtcggcgaaatcttcgcggaagaccagatctaccggatcgaccactacctcggc
aaggaacccgtgcagaacctgctcgcgctgcgcttcggcaacgcgctgttcgagccgctg
tggcgccgcgagtgggtcgagagcatccagatcacgatcgccgaggagctcggcgtcgaa
gcgcgcggcgatttctacgacaatacgggcgcgctgcgcgacatggtgcagaaccacctg
ctgcagctgctgtcgatcgtcgcgatggagccgccgcactcgatggattccgattccgtg
cgcgacgaaaagctgcgcgtgctgcgcgcgctgaagccggtcgatccgcgcgacatcggc
aaggtcgcggtgcgcggccagtatcatgcgggcgtgatcaagggcgtgcaggtgcccgcc
tatgcgaccgagccgggcgtgaagcccgacagccagaccgaaacgttcgtcgcgctgaag
gcggaaatcgaaaactggcgctgggccggcgtgccgttcttcctgcgcaccggcaagcgg
ctcgccgatcgcgtcgcggagatcgtcgtcaatttccggccggtcccgcattcggcgctc
gggccgaccgcgctgcgtcccggcgcgaaccgcctcgtgatccgtctgcagccgaacgag
acgattcgcctctactgcctcgcgaagcagccgggcgaaggaatgaatcttgccagcgtg
cacctcgatctcgcgttcgatcagttcttcaaggaaggacagatggaggcgtatcaacgc
ctgctgctcgacgtgatcaacggtcgcctcgcgctgttcgtgcgccgcgacgagcaggag
gccgcgtggcgctgggtcgagccgattctcaacgaatgggcgcgctcgctgaagccgccg
aagccctatgcggcaggcacgtgggggccggccgcgtcgagcgcgatgctcgcgcagcac
ggcacgtgctggctcgaagaagaaaactga

DBGET integrated database retrieval system