KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00883Help
Entry
BMULJ_00883       CDS       T00740                                 

Gene name
trbG
Definition
(GenBank) type IV secretion system protein
  KO
K20532  type IV secretion system protein TrbG
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMULJ_00883 (trbG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_00883 (trbG)
Secretion system [BR:bmj02044]
 Type IV secretion system
  Trb secretion system protein
   BMULJ_00883 (trbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: BAG42836
UniProt: A0A0H3KLK3
Position
1:complement(956740..957741)
Genome map
AA seq 333 aa AA seqDB search
MNLPFRFYAFVLMFAALSGCASQGKPPPTISLDEPVQAQPLPEPPKPVEVVAVPEPLALP
AQLKPLPKLDEAATAPEPADEKMRVSRANAEARIAPTREGYVNAIQVWPYSDGALYQVYA
APGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGSGEALRVNVLVKPTRSGLKTNLVIT
TSRRTYLLELTSTEKAWMASVSWDYPKDRMLALQRQAQAAQTAAPVDTGLALEKIRFRYT
ISGSNPPWKPQRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQGDGQLVNYRFRSPYYIVD
RLFGAAELRLGGDGGDVVRIERTDGAVGAARRN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcctttccgcttttacgctttcgtgctgatgttcgcagctctgtcgggttgc
gcctcgcaaggcaagccaccgccgaccatctcgctcgatgagccagtgcaggcgcagccg
ctgcccgaaccgcccaagccggtcgaagtcgtcgccgtgcccgagccactggcgctgccg
gcgcagttgaagccgctgccgaagctggacgaggcagcgaccgcgccggagccggccgac
gagaagatgcgcgtctcgcgcgccaatgccgaggcgcgcatcgcgccgacccgcgagggc
tacgtcaacgcgattcaggtgtggccgtatagcgacggcgcgttgtatcaggtctatgcg
gcaccggggcgcgtcaccgtggtttcgctccagcctggcgaggaactggtgacggtcgcc
gctggcgataccgtgcgctggatcgtcggcgacacgtccagcggcagcggcgaggcgttg
cgcgtcaatgtgctagtcaagcccacccgttcgggcctgaaaaccaatctggtcatcacc
accagccggcggacgtacctgctggaactgacttcgaccgagaaggcatggatggcctcg
gtgtcatgggactacccgaaagaccggatgctggccttgcagcgccaggcgcaggctgca
cagacagccgcgccggtcgataccggcctggcgttggagaagatccgcttccgctacacg
atcagcggcagcaatccgccgtggaagccgcagcgggccttcgatgatggcgagaaggtc
tacatccagttcccgccgggcatcgcgcaaggcgaactgccgccgctgttcgtcatcggc
gcgcagggtgacgggcaactggtcaattaccgtttccgttcgccgtactacatcgtggat
cgactctttggtgcggccgaactgcgcctgggtggcgatggtggtgacgtggtgcggatc
gagcgcaccgacggggctgtgggcgcagcgcggaggaactga

DBGET integrated database retrieval system