KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_00988Help
Entry
BMULJ_00988       CDS       T00740                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00540  Lipopolysaccharide biosynthesis
bmj01100  Metabolic pathways
Module
bmj_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BMULJ_00988 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bmj01005]
    BMULJ_00988 (rfaD)
Enzymes [BR:bmj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BMULJ_00988 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bmj01005]
 Unusual sugar
  BMULJ_00988 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR DapB_N
Motif
Other DBs
NCBI-ProteinID: BAG42934
UniProt: A9ADU8
Position
1:1059317..1060309
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANIVKALNERGETRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFVER
FARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGAQFLYASSAAIY
GGSTRFVEERSVEAPLNVYGYSKFLFDQVVRRVLPNAKSQIAGFRYFNVYGPRETHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYAAGEQTRDFVSVEDVAKVNLFFFDHPEKSGIFNL
GTGRAQPFNDIASTVVNTLRALDNLPPLTLAQQVEQGLIEYVPFPDALRGKYQCFTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLSGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactctcatcgtcaccggcgcggccggttttatcggcgcgaacatcgtcaaggcgctc
aacgagcgcggcgagacgcgcatcatcgcggtcgacaacctgacgcgcgcggacaaattc
aagaatctcgtcgattgcgagatcgacgactatctcgacaagaccgaattcgtcgagcgc
ttcgcgcgcggcgatttcggcaaggtgcgtgcggtgttccacgaaggcgcctgttcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgccgtg
ctcgacgcgtgcctcgcgcagggcgcgcagttcctgtatgcgtcgtcggcggcgatctac
ggcggctcgacgcgcttcgtcgaagagcgcagcgtcgaggcgccgctgaatgtgtacggc
tattcgaagttcctgttcgaccaggtcgtgcgccgcgtgctgccgaatgcgaagagccag
atcgcgggcttccgctatttcaacgtgtacggcccgcgcgaaacgcacaagggccgcatg
gcgtcggtcgcgttccacaacttcaaccagttccgcgcggaaggcaaggtgaagctgttc
ggcgagtacaacggctatgcggcgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gtcgcgaaggtgaacctgttcttcttcgatcatccggagaaatcgggcatcttcaacctc
ggcaccggccgcgcgcaaccgttcaacgacatcgcgtcgacggtcgtgaacacgctgcgc
gcactcgacaatctgccgccgctgacgctggcacagcaggtcgagcaggggctgatcgaa
tacgtgccgttcccggacgcgctgcgcggcaagtaccagtgcttcacgcaggccgaccag
acgaagctgcgtgcggccggctacgatgcgccgttcctgaccgtgcaggaaggcgtcgac
cgctacgttcgttggctgtccggccaggtttaa

DBGET integrated database retrieval system