KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01273Help
Entry
BMULJ_01273       CDS       T00740                                 

Gene name
gatA
Definition
(GenBank) aspartyl-tRNA/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00970  Aminoacyl-tRNA biosynthesis
bmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMULJ_01273 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmj03029]
    BMULJ_01273 (gatA)
Enzymes [BR:bmj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BMULJ_01273 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BMULJ_01273 (gatA)
Mitochondrial biogenesis [BR:bmj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BMULJ_01273 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAG43209
UniProt: A0A0H3KDQ3
Position
1:1354505..1355917
Genome map
AA seq 470 aa AA seqDB search
MTTTPLYELSAATLVDGYRRKTLSPVDVTQAVLARIDEWEPLIRATYALDRDGALAMARA
SEARWLRGEPAGPLDGVPVTIKENIATRGVPVPLGCAATELTPAADDSPPAARLRDAGAV
FVSKTTMPDFGLIGAAASSFHPLTRNPWDLSRNTGGSSSGAGAAAAAGYGPLHLGSDIGG
SVRIPAAFCGVFGFKPSFGRVPVDLPYPGRVTGPLTRTVQDAALAMQTIALPDARDHMSL
PYQPIEWLNLERDPKGLRIGLWIDPGNGVQVAAEVRAAIERAAAAFAAAGATVVPVRPWL
ARGALEAVARFWGARLRGTLAALPAARRELVAAFVRRRAEVVADATGDTIYAAYAQMLAL
RAQTVAATGEFDYVLSPTFPQPPFAAEATHIDQDGLHPIEQVVFTLAFNLSEQPAASINC
GYTRDGLPIGLQIAGRRFDDLGVLQLARCWEQMDTVRRPWPEAAAARAAA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccactccgctctacgaactcagtgccgcgacgctcgtcgacggctatcgccgc
aagacgctctcgcccgtcgacgtcacgcaggccgtgctggcgcgcatcgacgaatgggag
ccgctgatccgtgccacctatgcgctcgatcgcgacggcgcactcgcgatggcgcgcgcc
tcggaagcgcgctggctgcgcggcgaaccggccggtccgctcgacggcgtgccggtgacg
atcaaggaaaacatcgcgacgcgcggcgtgccggtgccgctcggctgcgcggcgacggaa
ctgacgccggctgccgacgattcgccgccggcggcacggttgcgcgacgcgggcgcggta
ttcgtcagcaagacgacgatgccggacttcgggctgatcggcgccgcggcgtcgagcttt
catccgctgacacgcaatccgtgggatctgagccgcaatacgggcggctcgagttcgggg
gccggcgcggccgcggcggccggctacgggccgctgcatctcggttccgacatcggcggc
tcggtgcgcattccggccgcgttctgcggcgtgttcggcttcaagccgagcttcggccgc
gtgccggtcgacctgccgtatccgggccgcgtgacggggccgctgacgcgaacggtgcag
gacgcggcgctcgcgatgcagacgatcgcgttgcccgatgcgcgcgatcacatgagcctg
ccgtatcagccgatcgaatggctgaatctcgagcgtgatccgaaagggctgcgcatcggt
ctgtggatcgatccgggcaacggcgtgcaggttgcggccgaggtgcgcgcggcgatcgag
cgtgcggccgccgcgtttgcggcggcgggcgcgacggtggtgccggtgcgcccgtggctc
gcacgcggcgcgctcgaagcggtcgcgcgtttctggggcgcgcggctgcgcggcacgctg
gccgcgttgcccgctgcgcggcgcgagctggtcgccgcgttcgtgcgccgccgcgcggaa
gtcgttgcggacgcaacgggcgatacgatctatgcggcgtatgcgcagatgctcgcgctg
cgcgcgcagacggtcgcggcgacaggcgagttcgattacgtgctgtcgccgacgtttccg
cagccgccgttcgcggccgaagcgacccatatcgaccaggacgggttgcatccgatcgag
caggtcgtgtttacgctcgcgttcaatctgtcggagcagccggccgcgtcgatcaactgc
ggctatacgcgcgacggcttgccgatcgggctgcaaatcgccgggcgccgcttcgacgat
ctcggcgtgctgcagctcgcgcgctgctgggaacagatggacacggtgcggcgcccgtgg
cccgaggcggcggccgcacgcgcggcggcctga

DBGET integrated database retrieval system