KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_01461Help
Entry
BMULJ_01461       CDS       T00740                                 

Gene name
thrS
Definition
(GenBank) threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMULJ_01461 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmj01007]
    BMULJ_01461 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmj03016]
    BMULJ_01461 (thrS)
Enzymes [BR:bmj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     BMULJ_01461 (thrS)
Amino acid related enzymes [BR:bmj01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BMULJ_01461 (thrS)
Transfer RNA biogenesis [BR:bmj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BMULJ_01461 (thrS)
 Prokaryotic type
    BMULJ_01461 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS DUF4228 DUF2533 tRNA-synt_2
Motif
Other DBs
NCBI-ProteinID: BAG43392
UniProt: A9ABF9
Position
1:1556115..1558022
Genome map
AA seq 635 aa AA seqDB search
MVSIRLPDGSVRQYEHPVTVAEVAASIGPGLAKAALGGKLDGELVDTSAVIDHDASLAIV
TDKDPDGLDIIRHSTAHLLAYAVKELYPDAQVTIGPVIDNGFYYDFAYHRPFTPEDLEKI
EKRMQELAKKDEPVTRRVVSRDEAAGYFRSIGEKYKAEIIESIPESDEIKLYSHGGFTDL
CRGPHVPSTGKLKVFKLMKVAGAYWRGDSKNEQLQRIYGTAWTKKEDQDQYLHMLEEAEK
RDHRKLGKQLDLFHMQEESPGMVFWHPKGWALWQQVEQYMRRRVNEAGYLEIKTPMIMDR
SLWEASGHWQNYRENMFTTESEKRDYAIKPMNCPGHVQVFKHGLRSYRDLPLRYAEFGSC
HRNEASGALHGLMRVRGFVQDDAHIFCTEEQIIAESIAFNKLAMSVYRDFGFDHIDIKLS
LRPEQRMGSDETWDRAEQGLREALTACGLQWEELPGEGAFYGPKIEYHIKDALGRSWQCG
TLQLDMMLPERLGAEYVAEDNSRRRPVMLHRAIVGSMERFLGILIEHHAGAMPVWLAPVQ
AVVLNIAESQVEYAQSLAQTLQKQGLRVTADLRNEKISYKIREHTLEKVPYLLVVGDKER
DAQTVAVRARGGVDLGVMPVEAFVERLQEDLRSFK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgatacgcttgcctgacgggtcagttcgacaatacgagcatccggtgacggtc
gccgaagtggcggcgtcgatcggtcccggccttgcgaaggctgcgctcggcggcaagctg
gacggcgaactcgtggatacgtccgccgtcatcgatcacgacgcatcgctcgcgatcgtc
accgacaaggatccggacggtctcgacatcatccgtcactcgaccgcgcacttgctggcc
tatgcggtgaaggagctctatccggacgcgcaggtcacgatcgggccggtcatcgacaac
ggcttctactacgatttcgcgtaccaccgcccgttcacgcccgaagatctggaaaagatc
gagaagcggatgcaggagctcgcgaagaaggacgagcccgtcacgcgccgtgtcgtgtcg
cgcgacgaggcggccggctacttccgcagcatcggcgaaaagtacaaggccgagatcatc
gagtcgattccggagagcgacgaaatcaagctttactcgcacggcggctttaccgacctg
tgtcgcggcccgcacgtgccgtcgaccggcaagctgaaggtcttcaagctgatgaaggtg
gccggcgcgtactggcgcggcgactcgaagaacgagcagctgcagcgcatttacggtacc
gcgtggaccaagaaggaagatcaggaccagtacctgcacatgctcgaggaagccgagaag
cgcgatcaccgcaagctcggcaagcagctcgacctgttccatatgcaggaagagtcgccc
ggcatggtgttctggcacccgaagggctgggcattgtggcagcaggtcgagcagtacatg
cgccgccgcgtgaacgaagccggctatctcgagatcaagacgccgatgatcatggaccgc
tcgctctgggaagcgtccggtcactggcagaactatcgcgagaacatgttcacgaccgag
tcggagaagcgcgactacgcgatcaagccgatgaactgccccggtcacgtgcaggtgttc
aagcacggcctgcgctcgtatcgcgacctgccgctgcgctacgcggaattcggctcgtgc
caccgcaacgaggcatcgggcgcgctgcacgggctgatgcgcgtacgcggcttcgtgcag
gacgacgcgcacatcttctgtaccgaagagcagatcattgccgagtcgatcgcgttcaac
aagctcgcgatgagcgtctatcgcgatttcgggttcgatcacatcgacatcaagctgtcg
ctgcgtcccgagcagcgcatgggttccgatgaaacctgggaccgtgcggagcaaggcctg
cgcgaagcgctgaccgcctgcggcctgcaatgggaagagctgccaggcgagggtgcgttc
tacggtccgaagatcgagtaccacatcaaggatgcgctcggccgttcgtggcagtgcggc
acgctgcagctcgacatgatgctgccggagcgtctcggcgccgagtacgtcgcggaagac
aacagccgccgccgcccggtcatgctgcaccgtgcgatcgtcggttcgatggagcgcttc
ctcggcattctgatcgagcaccatgcgggtgcaatgccggtctggctcgcgccggtgcag
gccgttgtgctcaatatcgccgaaagtcaggtcgaatatgcgcagtctctggcccaaacg
ttgcaaaaacaagggcttagagtgacggccgatttgcgcaacgagaagattagctataaa
atacgcgagcacacgctggaaaaggtgccttatctgctcgtcgtgggcgacaaggagcgt
gatgcacaaacggtagccgtgcgtgcccgtggcggcgtcgatcttggcgttatgccggtc
gaagccttcgttgagcgtctgcaggaagacctgcgctcgttcaagtaa

DBGET integrated database retrieval system