KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02193Help
Entry
BMULJ_02193       CDS       T00740                                 

Gene name
bdh
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00072  Synthesis and degradation of ketone bodies
bmj00650  Butanoate metabolism
bmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMULJ_02193 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BMULJ_02193 (bdh)
Enzymes [BR:bmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BMULJ_02193 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: BAG44094
UniProt: A0A0H3KPZ9
Position
1:complement(2359697..2360485)
Genome map
AA seq 262 aa AA seqDB search
MAADLSGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNLDGANAVADEINKAGGKAIG
VAMDVTNEEAVNTGIDKVAETFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFL
SAFPSAALTGQSVVVSHGWYMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatctgagcggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggc
aaggaaatcgcgctggagctggcgaaggcgggtgcggccgtcgcgatcgccgatctgaac
ctggacggcgcgaacgcggtcgccgacgagatcaacaaggccggcggcaaggcgatcggc
gtcgcgatggacgtgaccaacgaggaagccgtcaacaccggcatcgacaaggtcgcggag
acgttcggctcggtcgacattctcgtgtcgaatgccggcatccagatcgtgaacccgatc
gagaactactcgttcgccgactggaagaagatgcaggcgatccacgtcgacggcgcgttc
ctgacgaccaaggccgcgctcaagcacatgtacaaggacgatcgcggcggcgtcgtgatc
tacatgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcctacgtgacggcc
aagcacggcctgctcggtctcgcgcgcgtgctcgcgaaggaaggcgcgaagcacaacgtg
cgctcgcatgtcgtgtgtccgggtttcgtgcgcacgccgctcgtcgacaagcagattccc
gagcaggccaaggaactcggcatcagcgaagaggaagtcgtgaagaaggtgatgctcggc
aatacggtcgacggcgtgttcacgaccgtgcaggacgtcgcgcagacggtgctgttcctg
tcggcgtttccgagcgccgcgctgaccggtcagtcggtggtcgtcagccacggctggtat
atgcagtaa

DBGET integrated database retrieval system