KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02605Help
Entry
BMULJ_02605       CDS       T00740                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00020  Citrate cycle (TCA cycle)
bmj00640  Propanoate metabolism
bmj00660  C5-Branched dibasic acid metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMULJ_02605 (sucD)
   00640 Propanoate metabolism
    BMULJ_02605 (sucD)
   00660 C5-Branched dibasic acid metabolism
    BMULJ_02605 (sucD)
Enzymes [BR:bmj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMULJ_02605 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig DUF1611_N
Motif
Other DBs
NCBI-ProteinID: BAG44496
UniProt: A0A0H3KH54
Position
1:complement(2805666..2806547)
Genome map
AA seq 293 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPKKAGEDFEGIPIYASV
KEAKEETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMIEVKDRMRREGR
KTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLTYEAVAQLTALGLGQSSA
VGIGGDPINGLKHIDVMKMFNDDPDTDAVVMIGEIGGPDEANAAQWIKDNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAEAKLEIMEACGIKVTRNPSEMGRLLKAAL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctgatcaacaaggacacgaaggtcatcacgcagggcattaccggcaagacc
ggtcagttccacacgcgcgcctgccgtgaatatgcaaacggccgcgaagcattcgtcgcg
ggcgtgaacccgaagaaggccggcgaagatttcgaaggcattccgatctacgcgagcgtc
aaggaagcgaaggaagaaaccggcgcgaccgtgtcggtcatctacgttccgccggcaggc
gctgctgctgcgatctgggaagcggtcgaagccgatctcgatctcgcgatctgcatcacg
gaaggcattcccgtgcgcgacatgatcgaagtgaaggaccgcatgcgtcgcgaaggccgc
aagacgctgctgctcgggccgaactgcccgggcacgatcacgccggacgagctgaagatc
ggcatcatgccgggtcacatccaccgcaagggccgcatcggcgtcgtgtcgcgttcgggc
acgctgacgtatgaagccgtcgcgcagctcaccgcgctcggccttggccagtcgtcggca
gtcggtatcggcggcgacccgatcaatggtctgaagcacatcgacgtcatgaagatgttc
aacgacgatccggatacggatgcggtcgtgatgatcggcgaaatcggcggtccggacgaa
gcgaacgccgcgcagtggatcaaggacaacatgaagaagccggtcgtcggcttcatcgcg
ggcgtcacggcgcctccgggcaagcgcatgggccacgccggcgcgctgatctcgggcggt
gcggatacggccgaagcgaagctggaaatcatggaagcctgcggcatcaaggtcacgcgc
aacccgtcggaaatgggccgcctgctgaaggcagcgctgtaa

DBGET integrated database retrieval system