KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_02975Help
Entry
BMULJ_02975       CDS       T00740                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00860  Porphyrin and chlorophyll metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMULJ_02975 (hemB)
Enzymes [BR:bmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BMULJ_02975 (hemB)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMULJ_02975 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: BAG44860
UniProt: A0A0H3KI72
Position
1:3218057..3219055
Genome map
AA seq 332 aa AA seqDB search
MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTNERQPVPSMPGVERVSVD
LLMQVAEQCVELGVPVLSLFPAIEPALKTPDGREAGNPEGLIPRAVRELKKRFPELGVLT
DVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGVDIVAPSDMMDGRIGAIR
EMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGNKMTYQMDPANSDEALREV
RLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAMNGWLDHDKV
VLESLLAFKRAGADGVLTYFALDAARLLKAQR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccatccgcttcatcgtccgcgccggatgcgccgcgacgatttctcccggcgc
ctgatgcgcgaaaaccgcctgaccaccgacgatctgatctaccccgtgttcgtcgtcgaa
ggcacgaacgagcggcagcccgtgccgtcgatgcccggcgtcgagcgcgtatcggtcgat
ctgctgatgcaggtggccgagcagtgcgtcgaactgggcgtgccggtgctgtcgctgttc
cccgcgatcgagccggcgctgaagacgccggacggccgcgaggcgggcaaccccgaaggc
ttgattccgcgcgcggtgcgtgaactcaagaagcgcttccccgaactcggcgtgctgacc
gacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgagaacggc
tatgtgatcaacgacgatacgatcgagatcctgatcgagcaggcgcgcgcgcaggccgaa
gccggcgtcgacatcgtcgcgccgtcggacatgatggatgggcgcatcggcgcgattcgc
gagatgctcgaaagcgacgggcatatccatacgcgcatcatggcgtactcggccaagttc
gcgtccgcgttctacggcccgttccgcgatgcggtcggctcggcgtccaatctcggcaag
ggcaacaagatgacctaccagatggatcccgcgaacagcgacgaagcgctgcgcgaagtg
cgcctcgacatcgacgaaggcgcggacatggtgatggtcaagcccggcatgccgtatctc
gacatcgtgcgccgcgtgaaggacgaattccgctttccgacctacgtctatcaggtgagc
ggcgaatacgcgatgctgaaggccgccgcgatgaacggctggctcgaccacgacaaggtc
gtgctcgaatcgctgctcgcgttcaagcgcgcgggcgccgacggcgtgctcacatacttc
gcgctcgatgccgcgcgtctgctgaaagcgcaacgctga

DBGET integrated database retrieval system