KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03573Help
Entry
BMULJ_03573       CDS       T00740                                 

Gene name
cheB
Definition
(GenBank) chemotaxis family response regulator
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg DUF3419
Motif
Other DBs
NCBI-ProteinID: BAG45445
UniProt: A0A0H3KJR1
Position
2:407435..408460
Genome map
AA seq 341 aa AA seqDB search
MNIGIVNDLPLAVEALRRVLAQRPDHRVLWVASDGDEAVDFCVAHPPDLVLMDLVMPRLD
GVAATRAIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDTPTLALGLSADAPPQPL
LAKIDQIGRLLDSRAPAFVPLRPPVGAQRQPTLVAIGASAGGPTALATLLRTLPADFPAA
IVIVQHVDQAFALGMAEWLDGHTRLPVRVARHGCTPRAGEVLLAATNDHLCLSSRGVLGY
TREPADTPYRPSIDVFFDSVAECWRGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEA
TSAVYGMPKAAAAIGAASAILPLDRIAPQLIARVARRAARP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgatctgccgctcgcggtcgaggcactgcgccgcgtgctc
gcgcagcggcccgatcatcgcgtgctgtgggtcgcgtcggacggcgacgaggccgtcgat
ttctgcgtcgcgcatccgcccgatctcgtgctgatggatctcgtgatgccgcggctcgac
ggcgtcgcggcgacgcgcgcgatcatggcgcgcgcgccgtgcgcgatcctgatcgtcacc
gcgagcgtcagcgcgaatacctcgtcggtctacgaggcgatgggcgcgggtgcgctcgac
gcggtcgacacgccgacgctcgcgctcgggctctcggccgatgcgccgccgcagccgctg
ctcgcgaagatcgaccagatcggccggctgctcgacagccgcgccccggcgttcgtgccg
ctgcggccgccggtgggcgcgcagcgtcagccgacgctcgtcgcgatcggcgcgtcggcg
ggtgggccgaccgcgctcgccacgctgctgcggacgctgccggccgatttcccggccgcg
atcgtgatcgtccagcacgtcgaccaggcgttcgcgctcggcatggccgaatggctcgac
ggccacacgcggctgccggtgcgcgtcgcgcggcacggctgcacgccgcgcgccggcgag
gtgctgctcgcggcgaccaacgatcatctgtgtctgtcgtcgcgcggcgtgctcggctac
acgcgcgaaccggccgacacgccgtatcggccgtcgatcgacgtgttcttcgacagcgtc
gccgagtgctggcgcggcgacgcgctcggcgtgctgctgaccggcatgggccgcgacggc
gcgctcgggctcaaggcgatgcgcgcgaagggctgctatacgatcgcgcaggacgaagcg
acgagcgccgtgtacgggatgccgaaggcggccgccgcgatcggcgcggcatcggcgatc
ctgccgctcgaccggattgcgccgcagctgatcgcgcgcgtcgcgcgccgcgccgcgcgt
ccgtga

DBGET integrated database retrieval system