KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04594
Entry
BMULJ_04594       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB
Motif
Pfam: T6SS_VipA Nif11
Other DBs
NCBI-ProteinID: BAG46445
UniProt: A0A0H3KMI2
Position
2:complement(1600324..1600863)
AA seq 179 aa
MSASNSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPVEPLPAVSER
RFLEIDIDNFDERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIADKVEPLR
RLLQARTQLANLQTYMDGKSGAEALVTQLLQDPALLKSLAAAPRSERHEADAADSANAS
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccgctagcaattcgcagaagttcatcgcgcgcaatcgtgcgccgcgtgtgcagatc
gagtacgacgtcgaagtgtatggctcggagaagaaagtcgagcttccgttcgtgatgggc
gtacttgccgacctctccggcaagcatccggtcgagccgctgccggcggtgtccgagcgc
cggtttctggaaatcgacatcgacaacttcgacgagcgcatgaaggcgatccggccgcgc
gtcgcgtttgccgtgccgaatacgctgacgggcgaaggccagatgatggtcgacatgacc
ttcgaaagcatggaggacttctcgccggccgcgatcgccgacaaggtcgagccgctgcgc
cgcctgctccaggcgcgtacgcagctggcgaacctgcagacgtacatggacggcaagtcg
ggcgccgaggcgctcgtcacccagctgctgcaggacccggcgctgctgaagtcgctggct
gcggcgccgcggtcggagcggcacgaagcggacgcggccgattccgccaacgcgagctga

DBGET integrated database retrieval system