KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_04841Help
Entry
BMULJ_04841       CDS       T00740                                 

Gene name
glsA
Definition
(GenBank) glutaminase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: BAG46688
UniProt: A0A0H3KNP8
Position
2:1851996..1852910
Genome map
AA seq 304 aa AA seqDB search
MNYQPILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAQERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGANDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PETVVDAYCRQCAITMNCVELARAALFLANGGVAPATGERIVDPSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccaaccgattctcgaacgcatccataccgaactcgccccctggatcggccag
ggccgcgtggccgactacattcccgagctcgcgaaagtacccgccgacaagttcgggatg
gcggtcgtcacgctcgacggcaacgtttacacggtcggcgacgcgcaggagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctcggcgacgcg
ctgtgggaacgcgtcggccgcgaaccgtccggcaccgcgttcaattcgctcgtgcagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaacgcgggcgcgctcgtcgtcacc
gacgtgctgtgccgccgcttcgtgaaggcggaaaccgcgctcgtcgaattcgtgcggcga
ctgatcggcgcgaacgacatcgactacgattcgcgcgtcgcgctgtcggagctgcagcac
gcggagcgcaatcgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
ccggaaacggtcgtcgatgcgtattgccgtcagtgcgcgatcacgatgaactgcgtcgag
ctcgcgcgcgccgcgttgtttcttgcgaacgggggtgtggcgcctgcgaccggggagagg
atcgtcgatccgagttcggcgaaacggctgtcggcgctgatgctgacctgcggcacttat
gacgcggccggggatttcgtctatcgcgtcgggctgccggcgaagagcggcgtcggcggc
gggatcgttgcggtgctgcccggcgagatggcggtctgcgtgtgggcgccggggctcgat
gcgaacgggaattcgttggcagggacgttggcgttggagtggttgacgacttattcggga
aggtcgattttttga

DBGET integrated database retrieval system