KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05330Help
Entry
BMULJ_05330       CDS       T00740                                 

Gene name
malF
Definition
(GenBank) multiple sugar transport system permease protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Ribosomal_L32p RskA
Motif
Other DBs
NCBI-ProteinID: BAG47168
UniProt: A0A0H3KPL9
Position
2:2414735..2415673
Genome map
AA seq 312 aa AA seqDB search
MSSPLTSHSPAGAAASRDAAHALPARRPSPAARRQRRAAWLFLAPACAMVAVYVIWPILS
TLWLSLCNWDGMTERTFVGLANYVELLHAPTFYTALRNNVIWLVLFMLAPPLGLALALYL
NQAVGGIRLVKSLFFAPFVLSGVVVGLIFSWFYDPTFGLLALIAGHGIPVLGDARYATLG
VVFAALWPQTAYCMILYLTGLTSLNPEQIEAARMEGARGFALLWHVVLPQLRPTTFMAIV
VTVIGALRSFDLISVMTGGGPFESSTVLAYYMYDQAIKYYRLGYSASIAVVLFAIMLVYI
AFQLRRMLRNEQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtccgctcacgtcccattcgcccgccggcgcggccgcgtcgcgcgatgcggcg
catgcgctgcccgcgcgccgcccgtcgccggccgcgcggcggcagcgccgtgccgcctgg
ctgtttctcgcgccggcctgcgcgatggttgccgtctatgtgatctggccgatcctgtcg
acgttgtggctgagcctctgcaactgggacgggatgaccgagcgcacgttcgtcggcctc
gcgaactacgtcgagctgctgcacgcgccgaccttctacacggcgctgcgcaacaacgtg
atctggctcgtgctgttcatgctcgcgccgccgctcggcctcgcgctcgcgctgtacctg
aatcaggcggtcggcggaatccggctcgtgaagtcgctgttcttcgcgccgttcgtgctg
tcgggcgtcgtcgtcgggctgatcttctcgtggttctacgatccgaccttcggcttgctc
gcgctgatcgccggccacgggatcccggtgctcggcgacgcgcgctatgcgacgctcggc
gtcgtgttcgccgcgctgtggccgcagacggcgtactgcatgatcctctacctgaccggc
ctcacgtcgctgaaccccgagcagatcgaagcggcgcggatggaaggcgcgcgcggcttc
gcgctgctctggcacgtcgtgctgccgcagctgcgaccgacgacgttcatggcgatcgtc
gtcaccgtgatcggcgcgctgcgcagcttcgacctgatttcggtgatgacgggcggcggc
ccgttcgaaagttcgaccgtgctcgcgtattacatgtacgaccaggcgatcaagtactac
cggctcggctattccgcatcgatcgcggtcgtgctgttcgcgatcatgctcgtctatatc
gccttccagttgcgccggatgctgcgcaacgagcagtga

DBGET integrated database retrieval system