KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05335Help
Entry
BMULJ_05335       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haem_degrading GAF_2
Motif
Other DBs
NCBI-ProteinID: BAG47173
UniProt: A0A0H3KPM3
Position
2:2424246..2424650
Genome map
AA seq 134 aa AA seqDB search
MQMKPELELADADRILAAARAEAERNGWAVSIAVVDDGGHLLAFARLDGASPASAAIAQD
KARAAALGRRDTKAYEDMINGGRTAFLSAPLSGLLEGGVPVTAGGRVAGAIGVSGVKSVQ
DAQIARAGAQSVAD
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaagcccgaactcgaactcgccgacgccgaccgcatcctcgccgccgcacgc
gcggaggccgaacgcaacggctgggccgtgtcgattgcggtcgtcgacgacggcggccat
ctgctcgcgttcgcgcggctcgacggcgcgtcgccggcgagcgcggcgatcgcgcaggac
aaggcgcgcgcggcggcactcggccggcgcgacacgaaggcgtatgaggatatgatcaac
ggtggccgcaccgcgtttctcagcgcgccgctgtcgggcttgctcgaaggcggcgtgccg
gtgacggccggcggccgcgtcgcgggcgcgatcggcgtgtcgggcgtgaagtccgtgcag
gacgcgcagatcgcccgtgccggcgcacaaagcgtcgcggactga

DBGET integrated database retrieval system