KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05350Help
Entry
BMULJ_05350       CDS       T00740                                 

Definition
(GenBank) putative phytoene dehydrogenase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 FAD_oxidored DAO FAD_binding_3 GIDA Pyr_redox_2 HI0933_like MCRA
Motif
Other DBs
NCBI-ProteinID: BAG47187
UniProt: A0A0H3KXP7
Position
2:complement(2456419..2457654)
Genome map
AA seq 411 aa AA seqDB search
MIGAGLAGLSAAVELQRRGRRIVLHDAHAHAGGRCRSWFDSTLGTTVDSGLHRVFAGQAA
TQRYLRTIGAADQLTGPPSSEFPVVDLASQQRWTLRFGNRRWPSWLFDATARAPGTTPLD
YASLASLAFARTGRSLAQTMRCDGVLWERWLRPHFLRVLNVEPRHATAELARAALCGTLA
AGGPGCRPLVARHGLGSAFVEPALRMLQHGGAQIRLRSRLDALEFGARGNAVDALAAGGQ
RIDLAPGDAVVLAVPPDVAQPLVPDLAAPDAFGAVATAYFAAEPPPGAPLDTTVINGVAD
AVRTGEGQLAATVHDAGRWLDLPREALARRLWEDVARVTGANAAVVPPWQLVVEPRAGFA
AVPSQEMKRPAVRTRWTNLVLAGDWIATGLPATIEGAIRSGQQAADALQTQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggtgccggtctcgcgggcctgtcggccgccgtcgagctgcaacgtcgcgggcgg
cgcatcgtgctgcacgacgcgcatgcgcatgcgggcggccgttgccgctcgtggttcgac
tcgacgcttggtacgacggtcgacagcggcctgcatcgcgtgttcgccgggcaggcggcg
acgcaacgctatctgcgcacgatcggcgcggccgatcagctgacgggcccgccgtcgtcc
gagttcccggtcgtcgatctcgcgtcgcagcagcgctggacgctgcgcttcggcaatcgg
cgctggccgtcgtggctgttcgacgcgaccgcgcgcgcgcccggcacgacgccgctcgac
tatgcgtcgctcgcctcgctcgcgttcgcgcgcaccggacgctcgctcgcgcagacgatg
cgctgcgacggtgtgctctgggagcgctggctgcggccgcattttcttcgcgtgctgaac
gtcgagccgcgtcatgcgaccgccgagctggcgcgcgcggcgctgtgcgggacgctcgcg
gcgggcggcccgggctgccgtccgctcgtcgcgcggcacgggctcggtagcgcgttcgtc
gaaccggcgctgcggatgctgcagcacggcggcgcgcagatccggctgcgctcgcggctc
gatgcgctcgagttcggcgcgcgcggcaacgcggtcgacgcgctcgcggccggcgggcag
cgaatcgatctcgcgccgggcgacgcggtcgtgctggccgtgccgccggacgtcgcgcag
ccgctcgtgcccgatctggccgcgcccgacgcgttcggcgcggtcgcgaccgcctatttc
gcggccgagccgccgcccggcgcgccgctggacacgaccgtcatcaacggcgtcgccgat
gccgtgcgcaccggcgagggccagctcgcggcgacggttcacgacgccggccgctggctc
gacctgccgcgcgaggcgctcgcgcggcggctgtgggaagacgtggcgcgcgtgacgggc
gcgaacgcggcggtcgtgccgccgtggcagctcgtcgtcgagccgcgcgcgggatttgcg
gcggtgccgtcgcaggaaatgaaacgtccggccgtgcgtacgcgctggaccaaccttgtg
ctggcgggcgactggattgccaccggcttgcccgccacgatcgagggcgcgatccgttcc
ggccagcaggccgcggacgcgctccagacacaataa

DBGET integrated database retrieval system