KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05352Help
Entry
BMULJ_05352       CDS       T00740                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAG47189
UniProt: A0A0H3KPA0
Position
2:complement(2458815..2459147)
Genome map
AA seq 110 aa AA seqDB search
MNVDYLFYRKPDKPGPYSLDDLGDVAPPIGASDAVRAGIARVFEEIDWAESPDVPGAWFG
TGGAVFQFTAEPDGRVTSFMGSRLERRAMLQLTREMGLIALDLQRDIVYG
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgactatctcttctaccggaaaccggacaagcccggcccctactcgctcgac
gacctcggcgacgtcgcgccgccgatcggcgcgagcgacgcggtgcgcgccggcatcgcg
cgcgtgttcgaggaaatcgactgggccgaatcgccggacgtgccgggcgcctggttcggc
accggcggcgcggtgttccagttcacggccgaaccggacggccgcgtgacgagcttcatg
gggtcgcgcctcgagcgccgcgcgatgctgcagctgacgcgcgaaatggggctgatcgcg
ctcgatctgcagcgcgacatcgtctacggctga

DBGET integrated database retrieval system