KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05358Help
Entry
BMULJ_05358       CDS       T00740                                 

Definition
(GenBank) putative NADPH-dependent FMN reductase
  KO
K19784  chromate reductase, NAD(P)H dehydrogenase (quinone)
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    BMULJ_05358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: BAG47195
UniProt: A0A0H3KU94
Position
2:complement(2464966..2465517)
Genome map
AA seq 183 aa AA seqDB search
MAYRVAVVVGSLRRGSWNRALAHAVISLAPSDLSFEFVEIGELPLYSQDYDADFPEVAKR
FKQSIEAADALLFVTPEYNRSIPGVLKNALDWGSRPWGSNSWAGKPGAVLGTSPGATGTA
LAQQHLRNVLSYLDVKLLGQPEMFIKHDPTRIDDEGKIVNEDTRKFLQGFVDRYADWVRL
LKK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcgtgttgcagtcgtcgtcggcagcctgcgtcgcggttcgtggaaccgcgcg
ctcgcgcatgccgtgatctcgctcgccccgtcggacctgtcgttcgaattcgtcgagatc
ggcgaactgccgctgtacagccaggattacgacgcggattttccggaggtcgccaaacgg
ttcaagcagtcgatcgaagccgccgatgcgctgctgttcgtcacgcccgaatacaaccgc
tcgattccgggcgtgctgaaaaatgcgctcgactggggctcgcgcccgtggggttcgaat
tcgtgggccggcaagccgggcgccgtgctcggcacgtcgccgggtgcgaccggcacagcg
ctggcgcagcagcatctgcgcaacgtgctctcgtatctcgacgtgaagctgctcgggcag
cccgagatgttcatcaagcacgatccgacgcgcatcgacgacgaaggcaagatcgtcaac
gaagacacacgcaagttcctgcagggcttcgtcgaccgctacgcggactgggtccgcctg
ctgaagaagtaa

DBGET integrated database retrieval system